PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g06170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 1013aa    MW: 111642 Da    PI: 4.8877
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g06170genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.51.3e-12139948
                     HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     de+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
       CA08g06170  1 DEILCKAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 39
                     89*********************9.************986 PP

2Myb_DNA-binding48.22.6e-1569108848
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      Ede ++++vk++G++ W+tIa++++ gR +kqc++rw+++l
       CA08g06170  69 EDEVIAELVKKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 108
                      9************************.*************97 PP

3Myb_DNA-binding46.49.3e-15114156145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  l++a++ +G++ W+   + ++ gRt++ +k++w+
       CA08g06170 114 KEAWTQEEEVTLIHAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 156
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.722139IPR017930Myb domain
PfamPF139212.6E-10153No hitNo description
SuperFamilySSF466891.13E-11151IPR009057Homeodomain-like
SMARTSM007172.9E-4141IPR001005SANT/Myb domain
CDDcd001676.11E-9139No hitNo description
Gene3DG3DSA:1.10.10.601.2E-14153IPR009057Homeodomain-like
PROSITE profilePS5129425.10140112IPR017930Myb domain
CDDcd001671.54E-1247108No hitNo description
SMARTSM007172.0E-1061110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2369115IPR009057Homeodomain-like
PfamPF139213.9E-1469122No hitNo description
SuperFamilySSF466893.91E-2888164IPR009057Homeodomain-like
PROSITE profilePS5129419.025113163IPR017930Myb domain
SMARTSM007175.4E-14113161IPR001005SANT/Myb domain
CDDcd001671.05E-10116156No hitNo description
Gene3DG3DSA:1.10.10.602.1E-21116163IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1013 aa     Download sequence    Send to blast
DEILCKAVQR FKGKNWKKIA ECFKDRTDVQ CLHRWQKVLN PELVKGPWSK EVNICFIIHG  60
YSGTLGILED EVIAELVKKY GPKKWSTIAQ HLPGRIGKQC RERWHNHLNP GINKEAWTQE  120
EEVTLIHAHQ IYGNKWAELT KFLPGRTDNA IKNHWNSSVK KKLDVYLASG ALAKFPTLPN  180
VNHQNQSIPS SIKLQQSSED DSVRKEGTEM EEVSECSQSS NLAGCSQSTS DMGNTFVYTR  240
EEGKLLEDSN YRKDPSASSA PCSEYYTPAF EDITFSVAEV PSELAESKLL EHNFSQNWAT  300
SMGKDWQFNP DDIPNISPLE LMQDSSGFFM QCLTGTGNHD MVTFPQQNEM KFETTNDGSM  360
VVGLHKPNEM FTSVEGCSMV YPEAGIPQCF PSEIGMNGVD ETAGSMIYQI SEGGNMSIEK  420
CNPLCSDVMG TSSCQPCSVP SQFSSEQSSH MFGIPSNQFH NPSHTARESQ TNNCDGFLYP  480
MESDTPCDNI MDDPLLKDQL DQTSDSVQLV SVNDFRSTPS NTIQTCPLVN ENSAVKEDQM  540
DGGALCYEPP RFPSLDVPFF SCDLIQSGTD THQEYSPLGI RQLMMTSVNC LTPFKLWDSP  600
TRDGSPDAVL RSAAKTFTST PSILKKRHRD LVSPLSEKRC GKKLESDLRQ ESFSNLTKDF  660
SRLDVMFDDS ANEKAMPSLT KDQTLELQAS EDKENINPTE DGQKEEDKGR DGHSSCGTSG  720
RQLDGGEVHY KDQGTRESKR LGSKDAVGKI KQPSGVLVEL NASGLFFSPD RFGAKSDRGT  780
NLSNKALGNQ YSRRLEAASN QGSVSSSFET SSFSVICSPR IHGKKDGSSF VITTSMQSAP  840
TSTALESSAE TSGNGAGAGI IASISGETPY KRSIESPSAW KSPWFLNSFL SSPRLDNELT  900
FEDLALFMSP GDRSYDAIGL MKQLSEQTAG AFADAQEVLG GDTPESILRG RNSKNQNADE  960
NRSLLSANAM SERRTLDFSE CGSPEKEKET EKCSTNNNSF SSPSSYLLKG CR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-61116314159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-61116314159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0561230.0AB056123.1 Nicotiana tabacum NtmybA2 mRNA for Myb, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016537976.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_016537977.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A1U8DUZ00.0A0A1U8DUZ0_CAPAN; Uncharacterized protein
TrEMBLA0A2G2YXH80.0A0A2G2YXH8_CAPAN; myb-related protein 3R-1-like
STRINGSolyc08g068320.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31072448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-166Homeodomain-like protein