PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g00310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 294aa    MW: 32946.8 Da    PI: 7.7113
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g00310genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.5e-162673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l ++v   G g+W+  +++ g+ R++k+c++rw +yl
       CA08g00310 26 KGPWTPEEDEILTKYVSIEGEGRWRILPKKAGLLRCGKSCRLRWMNYL 73
                     79******************************99************97 PP

2Myb_DNA-binding48.71.8e-1579124148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg  T +E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
       CA08g00310  79 RGHITLDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 124
                      677799****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-221776IPR009057Homeodomain-like
PROSITE profilePS51294172173IPR017930Myb domain
SuperFamilySSF466895.31E-2923120IPR009057Homeodomain-like
SMARTSM007173.9E-132575IPR001005SANT/Myb domain
PfamPF002494.5E-142673IPR001005SANT/Myb domain
CDDcd001671.91E-102873No hitNo description
PROSITE profilePS5129424.68674128IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2477129IPR009057Homeodomain-like
SMARTSM007171.2E-1478126IPR001005SANT/Myb domain
PfamPF002493.9E-1479124IPR001005SANT/Myb domain
CDDcd001671.45E-1183124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MRTPSSSSSS RIKVLTPCCN KIGLKKGPWT PEEDEILTKY VSIEGEGRWR ILPKKAGLLR  60
CGKSCRLRWM NYLRPSVKRG HITLDEEDLI LRLHRLLGNR WSLIAGRIPG RTDNEIKNYW  120
NTHLSKKLIS QGIDPRTHKP LILNPNSSSD DNHITITNNK TNSSSSPSSS SKLANNDNLN  180
TINPNPISYN INNNNNRPGE ITSSGDCQHQ SCYAMLVNYD DDHMNIAVTT EGDDGMNCCT  240
DDVFSSFLNS LINEDMFNCQ NQQINGTLQD FDPFIASSTL SSNQNNPKRS MDE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-25241282105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-25212839159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-25212839159MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-25241282105C-Myb DNA-Binding Domain
1msf_C5e-25241282105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755132e-68HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016582090.10.0PREDICTED: transcription repressor MYB5-like
SwissprotQ388501e-79MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A1U8HFE20.0A0A1U8HFE2_CAPAN; Transcription repressor MYB5
TrEMBLA0A2G2YVN30.0A0A2G2YVN3_CAPAN; transcription repressor MYB5-like
STRINGSolyc01g005660.1.11e-142(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.13e-78myb domain protein 5
Publications ? help Back to Top
  1. Ranocha P,Francoz E,Burlat V,Dunand C
    Expression of PRX36, PMEI6 and SBT1.7 is controlled by complex transcription factor regulatory networks for proper seed coat mucilage extrusion.
    Plant Signal Behav, 2014. 9(11): p. e977734
    [PMID:25531128]