PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g21180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 299aa    MW: 33787.8 Da    PI: 6.7316
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g21180genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.3e-161764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W  eEd +l+  ++++G  +W++ ++  g+ R++k+c++rw +yl
       CA07g21180 17 KGPWNSEEDIRLIAFIQKHGHQNWRSLPKQAGLLRCGKSCRLRWINYL 64
                     79******************************99************97 PP

2Myb_DNA-binding54.13.7e-1770115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+e ++++++ +G++ W++Ia++++ gRt++++k+ w+++l
       CA07g21180  70 RGNFTPQEEETIIKLHQSFGNK-WSRIASHLP-GRTDNEIKNVWNTHL 115
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-23867IPR009057Homeodomain-like
PROSITE profilePS5129416.3091264IPR017930Myb domain
SuperFamilySSF466891.65E-2915111IPR009057Homeodomain-like
SMARTSM007177.3E-121666IPR001005SANT/Myb domain
PfamPF002496.8E-141764IPR001005SANT/Myb domain
CDDcd001672.00E-81964No hitNo description
PROSITE profilePS5129425.43565119IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2868119IPR009057Homeodomain-like
SMARTSM007171.8E-1569117IPR001005SANT/Myb domain
PfamPF002496.6E-1670115IPR001005SANT/Myb domain
CDDcd001672.34E-1072115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MMGKGRAPCC DKSKVKKGPW NSEEDIRLIA FIQKHGHQNW RSLPKQAGLL RCGKSCRLRW  60
INYLRPDVKR GNFTPQEEET IIKLHQSFGN KWSRIASHLP GRTDNEIKNV WNTHLKKRLM  120
KRLHGDKAKL DGTCANSQSS SSSTSVVSHT DDTSNEGKFK NVDANMIITK EEEEATKSCS  180
PTSSYASNLS NLSQVHEASS PNNVDMDWIF QFSEEPFPSS TARKVHDDDD EGIIEIPLEC  240
DVDFWDMLDI MGPSPSPPPP PPPNSESKLD HHSEASCQGL SEFERQKWFT YFERELGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-26171194105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-26171194105C-Myb DNA-Binding Domain
1msf_C4e-26171194105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579575.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A2G2Z6A00.0A0A2G2Z6A0_CAPAN; Myb-related protein
STRINGXP_009612238.11e-130(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.16e-79myb domain protein 58