PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g14180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 276aa    MW: 31980.4 Da    PI: 9.3158
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g14180genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.8e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++l+ +v+++G + +W+  +++ g+ R++ +c++rw +yl
       CA07g14180 14 KGPWTPDEDQKLLAYVEEHGYPcSWSDFPARAGLQRCGRSCRLRWINYL 62
                     79*********************************************97 PP

2Myb_DNA-binding53.26.8e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eE+  +++++++lG++ W++Ia++++ +R+++++k++w++
       CA07g14180  68 RGKFSSEEERTILRLHALLGNR-WSAIASHLP-NRSDNEIKNHWYT 111
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.55962IPR017930Myb domain
SuperFamilySSF466893.67E-2811109IPR009057Homeodomain-like
SMARTSM007173.6E-81364IPR001005SANT/Myb domain
PfamPF002496.2E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-221569IPR009057Homeodomain-like
PROSITE profilePS5129425.55163117IPR017930Myb domain
SMARTSM007176.8E-1767115IPR001005SANT/Myb domain
PfamPF002496.9E-1668111IPR001005SANT/Myb domain
CDDcd001672.51E-1170113No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2570118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGRSPCLDKE GLKKGPWTPD EDQKLLAYVE EHGYPCSWSD FPARAGLQRC GRSCRLRWIN  60
YLRPNIKRGK FSSEEERTIL RLHALLGNRW SAIASHLPNR SDNEIKNHWY TRLKKRLINM  120
GIDPMTHQPR RDGSNYKSLA SLSHMAEWET ARLEAEARLV RKRSTYNNNN KNNYNIILHQ  180
RRPCLDILKA WQMSGTKFLT INDISSMLLD GFLTNPRKTY TRNSPTPSMF NIEKSVEVGE  240
YLCPLFEDAI TKDNNLVQTE FSIIEGLADL FPEYD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-271211725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtFunctions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4686391e-72CU468639.4 S.lycopersicum DNA sequence from clone SL_MboI-101P13 on chromosome 4, complete sequence.
GenBankHG9755161e-72HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579476.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ9LE637e-82MY106_ARATH; Transcription factor MYB106
TrEMBLA0A2G2Z3S30.0A0A2G2Z3S3_CAPAN; Transcription factor
STRINGSolyc04g005600.1.11e-142(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.13e-81myb domain protein 16