PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g12950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 241aa    MW: 27876.3 Da    PI: 7.1971
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g12950genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed +l  +v+++G ++W+  +++ g+ R++k+c++rw ++l
       CA07g12950 14 RGAWSEDEDNKLRAYVERFGHPNWRQLPKYAGLMRCGKSCRLRWMNHL 61
                     89********************************************97 PP

2Myb_DNA-binding506.7e-1667122147
                      TSSS-HHHHHHHHHHHHHTTTT..........-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..........tWktIartmgkgRtlkqcksrwqky 47 
                      +g+ + eE++l+++++k+lG++          +W+ Ia+ ++ gR+++++k++w+ +
       CA07g12950  67 KGNYSLEEEQLIIKLHKELGNRnvpnrpnksfRWSVIAANLP-GRSDNDVKNHWHAH 122
                      7899**************************************.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.538965IPR017930Myb domain
SuperFamilySSF466895.99E-2511119IPR009057Homeodomain-like
SMARTSM007172.8E-121363IPR001005SANT/Myb domain
PfamPF002492.0E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-221568IPR009057Homeodomain-like
CDDcd001672.74E-101661No hitNo description
SMARTSM007171.2E-1466125IPR001005SANT/Myb domain
PROSITE profilePS5129415.00666127IPR017930Myb domain
PfamPF002492.9E-1467122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2169126IPR009057Homeodomain-like
CDDcd001673.38E-1069123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MVRTPIIDKN GIKRGAWSED EDNKLRAYVE RFGHPNWRQL PKYAGLMRCG KSCRLRWMNH  60
LRPGLKKGNY SLEEEQLIIK LHKELGNRNV PNRPNKSFRW SVIAANLPGR SDNDVKNHWH  120
AHLKKRVRLT NCINNSSMSM EQFTESTQSG SSQLDERSAS MNVVVDTSPT LLPTSFPEVS  180
SSDLYSITDW IEEESMEQLP ILSSMELLAA DTFSWTNYPI DNFQTESFDH FWTQPYDTFF  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23141277108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754404e-51HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579455.11e-169PREDICTED: myb-related protein Myb4-like
TrEMBLA0A2G2Z3Q11e-168A0A2G2Z3Q1_CAPAN; Myb-related protein Myb4
STRINGPGSC0003DMT4000976045e-93(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.14e-50myb domain protein 14