![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA07g04070 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 104aa MW: 11998 Da PI: 10.7519 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 30.9 | 6.2e-10 | 12 | 43 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg W + Ed++l+++v+ +G g+W+tI+++ g CA07g04070 12 RGFWKPAEDLILKNYVETHGEGNWATISEKSG 43 799**************************988 PP | |||||||
2 | Myb_DNA-binding | 42 | 2.1e-13 | 63 | 103 | 1 | 43 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 rg ++++E +l+++++k+lG++ W++Ia +++ gRt++++k++ CA07g04070 63 RGMMSEDEKDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEVKNF 103 6789******************.*********.********95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-10 | 6 | 41 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 8.771 | 7 | 50 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.39E-19 | 9 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.85 | 11 | 54 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.5E-7 | 12 | 43 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.56E-5 | 15 | 41 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-16 | 55 | 103 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.368 | 58 | 103 | IPR017930 | Myb domain |
SMART | SM00717 | 0.0037 | 62 | 103 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.1E-12 | 63 | 103 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.79E-8 | 66 | 103 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MRDKEVKKRM KRGFWKPAED LILKNYVETH GEGNWATISE KSGILKSFRL ITGGNYLRPN 60 IIRGMMSEDE KDLIIRLHKL LGNRWSLIAG RLPGRTDNEV KNF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-13 | 10 | 103 | 25 | 119 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 5 | 11 | VKKRMKR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF122054 | 2e-87 | AF122054.1 Solanum tuberosum clone 9 tuber-specific and sucrose-responsive element binding factor (TSF) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016553170.1 | 9e-56 | PREDICTED: transcription factor MYB82-like | ||||
Refseq | XP_016556998.1 | 8e-56 | PREDICTED: transcription factor MYB82-like | ||||
Swissprot | Q9LTF7 | 6e-43 | MYB82_ARATH; Transcription factor MYB82 | ||||
TrEMBL | A0A2G2Z0S1 | 2e-68 | A0A2G2Z0S1_CAPAN; Anthocyanin regulatory C1 protein | ||||
STRING | PGSC0003DMT400079416 | 7e-55 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G52600.1 | 3e-45 | myb domain protein 82 |