PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g03940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 215aa    MW: 24800.5 Da    PI: 9.5632
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g03940genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-181259148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEd++l+++v+ +G g+W+tI+++ g+ R++k+c++rw +yl
       CA07g03940 12 RGFWKPEEDLILKNCVETHGEGNWATISEKSGLLRSGKSCRLRWKNYL 59
                     799*****************************99************97 PP

2Myb_DNA-binding49.87.7e-1665110148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++++E +l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
       CA07g03940  65 RGMMSEDEKDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEVKNFWNTHL 110
                      6789******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.474163IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-21762IPR009057Homeodomain-like
SuperFamilySSF466896.97E-299106IPR009057Homeodomain-like
SMARTSM007172.5E-151161IPR001005SANT/Myb domain
PfamPF002491.6E-151259IPR001005SANT/Myb domain
CDDcd001674.55E-111559No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2263113IPR009057Homeodomain-like
SMARTSM007179.3E-1464112IPR001005SANT/Myb domain
PROSITE profilePS5129418.58664114IPR017930Myb domain
PfamPF002492.2E-1465110IPR001005SANT/Myb domain
CDDcd001671.93E-1068110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MKDKEVKTRM KRGFWKPEED LILKNCVETH GEGNWATISE KSGLLRSGKS CRLRWKNYLR  60
PNIKRGMMSE DEKDLIIRLH KLLGNRWSLI AGRLPGRTDN EVKNFWNTHL NNKRSCKGKK  120
KHVKSKEANT HSPQGKTQQC PAETVRNQEV ATKTVLDSWI EEMQDFNCSL LSPVMNNMPF  180
LEDEPFIPIL DDIVLLEAFT STGKEAWSEI QTFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-22121137107B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1220540.0AF122054.1 Solanum tuberosum clone 9 tuber-specific and sucrose-responsive element binding factor (TSF) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016556998.11e-159PREDICTED: transcription factor MYB82-like
SwissprotQ9LTF79e-61MYB82_ARATH; Transcription factor MYB82
TrEMBLA0A1U8FKZ81e-157A0A1U8FKZ8_CAPAN; Transcription factor MYB82
TrEMBLA0A2G2WB861e-157A0A2G2WB86_CAPBA; Transcription factor MYB82
TrEMBLA0A2G2Z0Z21e-157A0A2G2Z0Z2_CAPAN; transcription factor MYB82-like
TrEMBLA0A2G3BXZ61e-157A0A2G3BXZ6_CAPCH; Transcription factor MYB82
STRINGPGSC0003DMT4000794161e-148(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.13e-62myb domain protein 82