PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g00390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 343aa    MW: 38726.6 Da    PI: 6.1578
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g00390genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
       CA07g00390 14 KGPWSPEEDAKLKAYIEENGTGnNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding391.9e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
       CA07g00390  69 GGFTEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.408962IPR017930Myb domain
SuperFamilySSF466892.26E-2611109IPR009057Homeodomain-like
SMARTSM007172.3E-121364IPR001005SANT/Myb domain
PfamPF002497.8E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-241569IPR009057Homeodomain-like
CDDcd001678.12E-91662No hitNo description
PROSITE profilePS5129422.10963117IPR017930Myb domain
SMARTSM007172.3E-1167115IPR001005SANT/Myb domain
PfamPF002495.6E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2370117IPR009057Homeodomain-like
CDDcd001677.27E-871111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE ENGTGNNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FTEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
RKQSQMNRLL LANGGQDLKE LNGLEENPLL QNLSNSALER LQLHMQLQTL TNPLSFYNNP  180
SLWPKLTPLQ QKMIQTLQVN GLNEDQPPLY APINPSENHA QELGQKVGMN EFASTNFKVN  240
DQVEKSSPID VLDTNVGQEN TRDQIQIQGV QGFTQLEIDD LILSNKGSIG MNMNSEFDLA  300
WWSNEFDTNR ASASNSWGSS SNILQNTHDE MYQDYALGYN LQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23141177108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579276.10.0PREDICTED: transcription factor MYB36
SwissprotQ9FKL21e-101MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A1U8H7040.0A0A1U8H704_CAPAN; Transcription factor RAX2
TrEMBLA0A2G2Z0080.0A0A2G2Z008_CAPAN; transcription factor MYB36
TrEMBLA0A2G3BX290.0A0A2G3BX29_CAPCH; Transcription factor RAX2
STRINGPGSC0003DMT4000482610.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-96myb domain protein 36
Publications ? help Back to Top
  1. Fernández-Marcos M, et al.
    Control of Arabidopsis lateral root primordium boundaries by MYB36.
    New Phytol., 2017. 213(1): p. 105-112
    [PMID:27891649]