PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g27890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 236aa    MW: 26817.7 Da    PI: 5.4215
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g27890genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd+ll++++++ G ++W++ ++  g+ R++k+c++rw +yl
       CA06g27890 14 RGPWSKEEDDLLINYINKNGHPNWRALPKLAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding49.59.7e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T eE++ ++++++ lG++ W+tIa++++ gRt++++k+ w++
       CA06g27890  67 RGNFTNEEEDTIIKLHQVLGNR-WSTIAARLP-GRTDNEIKNIWHT 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.277961IPR017930Myb domain
SuperFamilySSF466891.1E-2911108IPR009057Homeodomain-like
SMARTSM007174.2E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001674.80E-101661No hitNo description
PROSITE profilePS5129425.09362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-2665116IPR009057Homeodomain-like
SMARTSM007172.6E-1366114IPR001005SANT/Myb domain
PfamPF002496.8E-1467110IPR001005SANT/Myb domain
CDDcd001671.01E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MGRTPCCEKL GLKRGPWSKE EDDLLINYIN KNGHPNWRAL PKLAGLLRCG KSCRLRWTNY  60
LKPDIKRGNF TNEEEDTIIK LHQVLGNRWS TIAARLPGRT DNEIKNIWHT RLKKKISKSQ  120
AQKTPELQEE TSMETSKSDE QNLDTHLEPE NSNLDIHLES DNSKDNSEIS SPKTNNEIQQ  180
QSSSSVHSSS SISSSSEDAC SNTTATSPEP RDQFMLDNLV EIDDDFWSEL MKIDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a regulatory role in meristem function. Functions as component of a regulatory network controlling the establishment and/or development of the shoot system by the regulation of apical meristem function (PubMed:9681014). May play a role in tolerance to boric acid (PubMed:16861809). {ECO:0000269|PubMed:16861809, ECO:0000269|PubMed:9681014}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), drought, light and wounding in leaves. Down-regulated by drought and ABA in roots. {ECO:0000269|PubMed:9681014}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576820.11e-166PREDICTED: myb-related protein Myb4-like
SwissprotQ9LNC91e-72MYB13_ARATH; Transcription factor MYB13
TrEMBLA0A2G2ZEK01e-167A0A2G2ZEK0_CAPAN; Myb-related protein Zm1
STRINGXP_009770485.11e-108(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06180.13e-74myb domain protein 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Huang BH, et al.
    Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae).
    Int J Mol Sci, 2015. 16(3): p. 5900-21
    [PMID:25782156]