PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g25180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 458aa    MW: 51650.1 Da    PI: 7.0933
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g25180genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-17118164148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd +l+++vkq+G + W+ Ia++mg  R +kqc++rw+++l
       CA06g25180 118 KGQWTDEEDSKLLRLVKQFGVRKWAQIAEKMG-ARAGKQCRERWHNHL 164
                      799*****************************.*************97 PP

2Myb_DNA-binding574.5e-18170212145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eE++llv+++k+lG++ W+ Ia++++ gRt++ +k++w+
       CA06g25180 170 KDTWSEEEELLLVELHKLLGNK-WAEIAKRIP-GRTENAIKNHWN 212
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.998113168IPR017930Myb domain
SMARTSM007171.1E-15117166IPR001005SANT/Myb domain
SuperFamilySSF466891.26E-29117211IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-26119170IPR009057Homeodomain-like
CDDcd001675.68E-15121164No hitNo description
PfamPF139215.3E-20121180No hitNo description
SMARTSM007174.0E-17169217IPR001005SANT/Myb domain
PROSITE profilePS5129421.2169219IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.2E-21171217IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MDGESAFLPY QNLPKNNHPP LSAIDRFLLS HENYFPQQKS NENALGEFSH FVGANASSNR  60
YANGISWPTL PESSYMEELF VNEVHKNNSL LGHEQKNKTK ESGKKTKEGN STTNYLIKGQ  120
WTDEEDSKLL RLVKQFGVRK WAQIAEKMGA RAGKQCRERW HNHLRPDIKK DTWSEEEELL  180
LVELHKLLGN KWAEIAKRIP GRTENAIKNH WNATKRRQNS RRNKNKKTQQ ADGTQCENKS  240
HRSTVLQDYI RSKYFMNDDN SPLTATLYYG SGGTASGGST SNATNTTPTY SDDDSPYLIT  300
HQTYDEEMNF MQSLFGNSNI INGTKVMGTM ETNVVTQDLL DKSSSSSSFG LNSSGENPLA  360
QCNVESYTTT KRVIADNNAR NYIPDYSQYY PQDLYLSRLL DGSLVPNYSD CFECGSMNNQ  420
AGCSSSGGNI KEVDLMEMMN STNSQFSQPG TFNKTFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-421162185107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754453e-78HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576232.10.0PREDICTED: transcription factor MYB51-like
TrEMBLA0A1U8GYC30.0A0A1U8GYC3_CAPAN; transcription factor MYB51-like
STRINGSolyc06g076840.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48251941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.18e-52myb domain protein 119