PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g25110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 307aa    MW: 34474.5 Da    PI: 9.7103
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g25110genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.23.3e-072468345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +WT+ E + + +a +++ ++   +W ++a++++ g++  +++  + 
       CA06g25110 24 KWTPAENKAFENALALFDKDtpdRWQRVAEMVP-GKSVGDVIRQYK 68
                     8********************************.***999988875 PP

2Myb_DNA-binding47.54.1e-15131175347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
       CA06g25110 131 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 175
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.5182073IPR017884SANT domain
SMARTSM007173.0E-92173IPR001005SANT/Myb domain
SuperFamilySSF466894.88E-112378IPR009057Homeodomain-like
CDDcd001676.17E-72470No hitNo description
PfamPF002492.4E-62468IPR001005SANT/Myb domain
PROSITE profilePS5129419.89124180IPR017930Myb domain
SuperFamilySSF466895.31E-17125179IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-17127179IPR006447Myb domain, plants
SMARTSM007172.5E-12128178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-12129175IPR009057Homeodomain-like
CDDcd001671.35E-11131176No hitNo description
PfamPF002499.8E-13131175IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MEILSPAPYL ANPSWFLDEG KSTKWTPAEN KAFENALALF DKDTPDRWQR VAEMVPGKSV  60
GDVIRQYKEL EDDVSRIEAG LITIPGYSTS PFTLEWGNSH SFDGYKQTYV VGGKRPLSSR  120
PPEQERKKGI PWTEEEHKLF LMGLKKYGKG DWRNISRNFV VTRTPTQVAS HAQKYFIRQL  180
SGGKDKRRAS IHDITTINLH DNQTSSPDYQ KPTSPDQPAV ISQQPKSAAN AVHKMPFQWN  240
QANNGTAMGF NSAQGSLFMS PLYGGNSYGN NKMQSQSLQR GALHEPYFGS QSMNFQLQSA  300
HQYHQA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-142090676RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016577712.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-148DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A2G2ZE220.0A0A2G2ZE22_CAPAN; Transcription factor DIVARICATA
STRINGPGSC0003DMT4000780290.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-103MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]