PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g24340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 226aa    MW: 26352.4 Da    PI: 6.3657
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g24340genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.4e-15855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++lv +vk++G ++W+  a+  g++R++k+c++rw +yl
       CA06g24340  8 KGPWTEQEDLQLVFYVKMFGDRRWDFLAKVSGLKRSGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding56.37.1e-1861106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++l ++++ ++G++ W++Ia +++ gRt++++k++w++++
       CA06g24340  61 RGKMTPHEEQLVLQLHSKYGNR-WSKIAGKLP-GRTDNEIKNYWRTHM 106
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.249355IPR017930Myb domain
SuperFamilySSF466891.72E-296102IPR009057Homeodomain-like
SMARTSM007171.3E-12757IPR001005SANT/Myb domain
PfamPF002494.7E-14855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-20962IPR009057Homeodomain-like
CDDcd001679.35E-91055No hitNo description
PROSITE profilePS5129426.35856110IPR017930Myb domain
SMARTSM007173.2E-1760108IPR001005SANT/Myb domain
PfamPF002498.8E-1661105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-2563108IPR009057Homeodomain-like
CDDcd001671.72E-1163106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MVQEEVRKGP WTEQEDLQLV FYVKMFGDRR WDFLAKVSGL KRSGKSCRLR WVNYLNPGLK  60
RGKMTPHEEQ LVLQLHSKYG NRWSKIAGKL PGRTDNEIKN YWRTHMRKLA QDEKKNNKAS  120
ISPSSSNFSN CSSSSANSPA VDSSTEQNEL LQVVEANKTY EEDQNMMVYS MDEIWKEVES  180
SQEIETRNDL PVMASNTWDY CPDSLWMTHD HYYYDNTQDF SFFTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2851081103MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-28110820126MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016577798.11e-170PREDICTED: transcription factor MYB59-like isoform X2
SwissprotQ4JL845e-71MYB59_ARATH; Transcription factor MYB59
TrEMBLA0A1U8H9L11e-169A0A1U8H9L1_CAPAN; Transcription factor MYB48
TrEMBLA0A2G2WNH31e-169A0A2G2WNH3_CAPBA; Transcription factor MYB48
TrEMBLA0A2G2ZE381e-169A0A2G2ZE38_CAPAN; transcription factor MYB59-like isoform X2
STRINGXP_009798979.11e-106(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.31e-68myb domain protein 59
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nishida S,Kakei Y,Shimada Y,Fujiwara T
    Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana.
    Plant J., 2017. 91(4): p. 741-753
    [PMID:28586097]
  4. Hickman R, et al.
    Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network.
    Plant Cell, 2017. 29(9): p. 2086-2105
    [PMID:28827376]