PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g22300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 506aa    MW: 55341.6 Da    PI: 5.3345
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g22300genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.43e-173986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
       CA06g22300 39 KGPWTSAEDAILMDYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding52.31.3e-1692135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
       CA06g22300  92 KGAFTPEEERRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4323486IPR017930Myb domain
SuperFamilySSF466894.12E-3036133IPR009057Homeodomain-like
SMARTSM007172.8E-123888IPR001005SANT/Myb domain
PfamPF002491.4E-143986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-244093IPR009057Homeodomain-like
CDDcd001673.76E-104186No hitNo description
PROSITE profilePS5129426.47487141IPR017930Myb domain
SMARTSM007171.8E-1691139IPR001005SANT/Myb domain
PfamPF002491.4E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2694140IPR009057Homeodomain-like
CDDcd001673.54E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MSMTSESDDR MASQDGVDSP SVEEACGGGI TGGGLPLKKG PWTSAEDAIL MDYVTKHGEG  60
NWNAVQKHSG LARCGKSCRL RWANHLRPDL KKGAFTPEEE RRIIELHAKM GNKWARMAAE  120
LPGRTDNEIK NYWNTRIKRR QRAGLPIYPP DISFQAISEN KQNEELGAFS STDSQYPDFL  180
PMNNFEIPAV EFKRLEFNKQ LCPPALLDIP NGGILDIPGR SLLAQGLNSA YYSRSFLSTM  240
PPAKRIRGAE SLFSGLNGDC SPSKNEGSFP TCHQYQDDGS LLAQSMGFSS SFNQNLTSVH  300
HPSSSGVIPG SHAPLNGKTS SSEPLWAEKL ELPSFQSQMA SWGLSSSPLP SLESVDTVIQ  360
SPPTEHTESC NLSPRNSGLL DAVLYESQTM RASKSILHQE NSGDVVDNSC PDLHETGWET  420
YGDPISPLGH SAASVFSEYT PTSGSSPEEP QLVTMPGCKV KQEKFDFGPY DGKEDASDLI  480
FSRPDYLLES NCFGHMQKTA RSIWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-32341401107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1754750.0EF175475.1 Solanum lycopersicum GAMYB-like2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016578021.10.0PREDICTED: LOW QUALITY PROTEIN: transcription factor GAMYB-like
TrEMBLA0A2G3C6T90.0A0A2G3C6T9_CAPCH; Myb-related protein
STRINGSolyc06g073640.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.12e-83myb domain protein 33