PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g19980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 320aa    MW: 36977.5 Da    PI: 6.8522
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g19980genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W+++Ede+l+++++++G g+W+++++  g+ R++k+c++rw +yl
       CA06g19980 14 RGLWSPDEDEKLYNYITRFGVGCWSSVPKLSGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding50.16.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE++ ++ +++ lG++ W+ Ia++++ gRt++++k++w++yl
       CA06g19980  67 RGTFSLEEEDMIITLHEVLGNR-WAQIAAKLP-GRTDNEIKNYWNSYL 112
                      899*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.342961IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-23964IPR009057Homeodomain-like
SuperFamilySSF466898.07E-2912108IPR009057Homeodomain-like
SMARTSM007172.4E-111363IPR001005SANT/Myb domain
PfamPF002498.8E-141461IPR001005SANT/Myb domain
CDDcd001671.09E-91761No hitNo description
PROSITE profilePS5129425.97362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2665117IPR009057Homeodomain-like
SMARTSM007172.1E-1666114IPR001005SANT/Myb domain
PfamPF002497.4E-1567112IPR001005SANT/Myb domain
CDDcd001672.69E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRHSVYVKE KLRRGLWSPD EDEKLYNYIT RFGVGCWSSV PKLSGLQRCG KSCRLRWINY  60
LRPDLKRGTF SLEEEDMIIT LHEVLGNRWA QIAAKLPGRT DNEIKNYWNS YLKKKLIKQG  120
IDPITHKPLS ENHQVRNDTN CTDKASMLLM SKFPNMSNSV EIEQPFHFNK RIFNSEAITR  180
QLTEVSRNQL VSKQVFDPLF LYDFQANMNP IGPYDGNQDF GICSMPNLTN FEHGHMTESD  240
FSDSSTSRMS TSNRTNTMIR HHSSAGIHQM NEMLENSQEL TWDADNKIDS LFEYPYDGIK  300
NEEDFSNNNN NNNPLSSLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-126HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016578263.10.0PREDICTED: myb-related protein 315-like isoform X1
TrEMBLA0A1U8HAV90.0A0A1U8HAV9_CAPAN; Transcription factor MYB32
TrEMBLA0A2G2Y0M00.0A0A2G2Y0M0_CAPAN; myb-related protein 315-like isoform X1
STRINGPGSC0003DMT4000696440.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.17e-76myb domain protein 50