PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g00320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 295aa    MW: 34084 Da    PI: 4.4817
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g00320genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEde+l +++   G g+W++ ++  g+ R++k+c++rw +yl
       CA06g00320 14 KGRWTKEEDEILTNYILANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding44.63.2e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E+ +++++ + lG++ W+ Ia++++ gRt++++k++w++
       CA06g00320  67 RGNITSDEEAIIIKLRATLGNR-WSVIAEYLP-GRTDNEIKNYWNS 110
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-21564IPR009057Homeodomain-like
PROSITE profilePS5129414.966961IPR017930Myb domain
SuperFamilySSF466899.77E-2711108IPR009057Homeodomain-like
SMARTSM007176.0E-111363IPR001005SANT/Myb domain
PfamPF002493.6E-131461IPR001005SANT/Myb domain
CDDcd001673.09E-71661No hitNo description
PROSITE profilePS5129421.27962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2265116IPR009057Homeodomain-like
SMARTSM007173.4E-1466114IPR001005SANT/Myb domain
PfamPF002491.1E-1267110IPR001005SANT/Myb domain
CDDcd001671.29E-871112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRTPCCEKV GLRKGRWTKE EDEILTNYIL ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LKTDLKRGNI TSDEEAIIIK LRATLGNRWS VIAEYLPGRT DNEIKNYWNS RLSRKVESLR  120
IPSDEKLPLA VVEMAKNKGI QEQIVKRQRR KRKADSNFMT ETSVSTSSCY NNNNNNNNND  180
DDVVLMDDKD AELDQDFIFN CLWDCEGEDL EIVENNNNEV LSNDNYDQLD CWNWEQLDEI  240
LANEEATRQE IDNNMSHISL FDINDNVQNC MNQQEVPIEN VHPMQSDLVA WLLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtFlavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269|PubMed:19895401}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755182e-44HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016555562.10.0PREDICTED: transcription factor MYB12-like
SwissprotQ9FJ076e-68MY111_ARATH; Transcription factor MYB111
TrEMBLA0A1U8F8B80.0A0A1U8F8B8_CAPAN; transcription factor MYB12-like
STRINGPGSC0003DMT4000188411e-137(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.11e-67myb domain protein 111
Publications ? help Back to Top
  1. Pandey A,Misra P,Bhambhani S,Bhatia C,Trivedi PK
    Expression of Arabidopsis MYB transcription factor, AtMYB111, in tobacco requires light to modulate flavonol content.
    Sci Rep, 2014. 4: p. 5018
    [PMID:24846090]
  2. Lotkowska ME, et al.
    The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress.
    Plant Physiol., 2015. 169(3): p. 1862-80
    [PMID:26378103]
  3. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  4. Zhou Z,Schenke D,Miao Y,Cai D
    Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings.
    Plant Cell Environ., 2017. 40(3): p. 453-458
    [PMID:28032363]
  5. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  6. Duan S, et al.
    Functional characterization of a heterologously expressed Brassica napus WRKY41-1 transcription factor in regulating anthocyanin biosynthesis in Arabidopsis thaliana.
    Plant Sci., 2018. 268: p. 47-53
    [PMID:29362083]