PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g19360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB_related
Protein Properties Length: 193aa    MW: 21960.3 Da    PI: 5.6322
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g19360genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.1e-14101145347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
       CA05g19360 101 PWTEEEHRLFLIGLEKYGKGDWRSISRNVVVSRTPTQVASHAQKY 145
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.9152IPR001005SANT/Myb domain
PROSITE profilePS512937.664148IPR017884SANT domain
SuperFamilySSF466893.16E-9456IPR009057Homeodomain-like
CDDcd001678.57E-5446No hitNo description
PROSITE profilePS5129422.46494150IPR017930Myb domain
SuperFamilySSF466893.04E-1796150IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-1897149IPR006447Myb domain, plants
SMARTSM007177.7E-1298148IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-1298144IPR009057Homeodomain-like
CDDcd001671.45E-10101146No hitNo description
PfamPF002493.5E-12101145IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSIWSRNDDK LFENALVLYP ENIADRFQLI ADYVPGKSID DIMAHYDDLV HDVFEIDSGR  60
IEFPGYTDDD SGRVELEGHS GRVELEGDSG RVSAERKKGT PWTEEEHRLF LIGLEKYGKG  120
DWRSISRNVV VSRTPTQVAS HAQKYFIRQQ AMKKERKRSS IHDITTAVDT NTVPPQSSLQ  180
NQRGTQNFNF AQ*
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2433391e-109AJ243339.1 Lycopersicon esculentum mRNA for I-box binding factor (LeMYBI gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573777.11e-142PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-56DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1U8GR701e-141A0A1U8GR70_CAPAN; Transcription factor MYB1R1
TrEMBLA0A2G2ZKM71e-141A0A2G2ZKM7_CAPAN; transcription factor DIVARICATA-like
STRINGPGSC0003DMT4000604031e-107(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-67MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]