PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g18430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 401aa    MW: 44687.7 Da    PI: 4.7414
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g18430genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEdellv++++  G g+W++ ++  g+ R++k+c++rw +yl
       CA05g18430 13 RGKWTIEEDELLVKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWTNYL 60
                     89******************************99************97 PP

2Myb_DNA-binding57.82.4e-1866110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEde +v+++  lG++ W++Ia+ ++ gRt++++k++w++ 
       CA05g18430  66 RGKFTAEEDETIVKLHSTLGNR-WSLIAQDLP-GRTDNEIKNYWNSN 110
                      89********************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-22463IPR009057Homeodomain-like
PROSITE profilePS5129416.979860IPR017930Myb domain
SuperFamilySSF466891.27E-2910107IPR009057Homeodomain-like
SMARTSM007171.1E-111262IPR001005SANT/Myb domain
PfamPF002491.7E-141360IPR001005SANT/Myb domain
CDDcd001672.84E-81560No hitNo description
PROSITE profilePS5129426.64761115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2664115IPR009057Homeodomain-like
SMARTSM007173.2E-1765113IPR001005SANT/Myb domain
PfamPF002492.1E-1666110IPR001005SANT/Myb domain
CDDcd001671.88E-1168111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MKAPCCEKVG LKRGKWTIEE DELLVKYIQA NGEGSWRSLP KNAGLLRCGK SCRLRWTNYL  60
RPNLKRGKFT AEEDETIVKL HSTLGNRWSL IAQDLPGRTD NEIKNYWNSN LRRRLYSFRN  120
FKELIKTTTN VPKIAVDGDS DESLRKQDTS TMSKEGSIES LLPEDNIVVD RGSTRKNRSL  180
CVGSNEGATW SEGDSTESLL PENCTVDIGS MRKPYSSCPR GKDDVPWYRE GSTESLLLEN  240
IEINFACEEN SIGSLLMENC SSPGGRDDTS WFEEGGSFKS LLLENIETNF SCPKGTCNAT  300
WSEGGSVEFF SLENCVVDLG SNRENKPVWS DKGGSIEYLL TENYTVDIGF NRETNSSSCP  360
RGNAKAMWYE EGSSIESSST ESYIVDLGKT SQTSSILINV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-26111152105C-Myb DNA-Binding Domain
1msf_C1e-26111152105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016574541.10.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A1U8GTF10.0A0A1U8GTF1_CAPAN; transcription factor MYB108-like
STRINGPGSC0003DMT4000602361e-153(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.14e-64myb domain protein 111