PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g16780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 238aa    MW: 27907.7 Da    PI: 9.9118
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g16780genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.9e-191360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd+ll+++v+++G g+W+++ar  g++R +k+c++rw +yl
       CA05g16780 13 KGPWTVEEDKLLIEYVNLHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 60
                     79********************************************97 PP

2Myb_DNA-binding48.22.5e-1566110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++ +G++ W+tIar ++ gRt++++k++w+++
       CA05g16780  66 RGQITPYEESIILELHAIWGNR-WSTIARSLP-GRTDNEIKNYWRTH 110
                      6788999***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.079864IPR017930Myb domain
SuperFamilySSF466892.75E-3011107IPR009057Homeodomain-like
SMARTSM007177.1E-171262IPR001005SANT/Myb domain
PfamPF002493.8E-181360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-231467IPR009057Homeodomain-like
CDDcd001671.29E-111560No hitNo description
PROSITE profilePS5129419.09165115IPR017930Myb domain
SMARTSM007173.1E-1365113IPR001005SANT/Myb domain
PfamPF002496.3E-1366110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-2468116IPR009057Homeodomain-like
CDDcd001679.95E-970111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MGRWGIIEEE WRKGPWTVEE DKLLIEYVNL HGEGRWNSVA RLAGLKRNGK SCRLRWVNYL  60
RPDLKRGQIT PYEESIILEL HAIWGNRWST IARSLPGRTD NEIKNYWRTH FKKKVKKSST  120
DNFEKTKARL LKRQQSQQKQ LLNSQIDMKR FMSQNENKVP SHVPKQDMAI LYQNNSFHEQ  180
EQSGFFYSMN NGYAIVPEAS SNEDIMWDIG LWNLDDFNVN LPVSAVESGF AIKEFKI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27131157108B-MYB
1h8a_C5e-27311516128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-50HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355751.11e-135PREDICTED: transcription factor MYB24-like
TrEMBLA0A2G2ZJQ81e-175A0A2G2ZJQ8_CAPAN; Myb-related protein
STRINGPGSC0003DMT4000699551e-134(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.15e-78myb domain protein 305