PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g16530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 318aa    MW: 36803.7 Da    PI: 6.7888
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g16530genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.4e-183986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  l++ ++ +G g+W++ ar+ g++Rt+k+c++rw++yl
       CA05g16530 39 RGPWTVEEDFTLINFIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 86
                     89********************************************97 PP

2Myb_DNA-binding51.32.7e-1692135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
       CA05g16530  92 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 135
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4593486IPR017930Myb domain
SuperFamilySSF466898.99E-3136133IPR009057Homeodomain-like
SMARTSM007175.1E-153888IPR001005SANT/Myb domain
PfamPF002495.0E-163986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-224093IPR009057Homeodomain-like
CDDcd001671.43E-114186No hitNo description
PROSITE profilePS5129423.24687141IPR017930Myb domain
SMARTSM007171.3E-1491139IPR001005SANT/Myb domain
PfamPF002495.4E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-2394140IPR009057Homeodomain-like
CDDcd001673.39E-7112135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MDHHQKIEVD SGRGGGRGVD YTKNNQEIRE EDIVMDLRRG PWTVEEDFTL INFIAHHGEG  60
RWNSLARCAG LKRTGKSCRL RWLNYLRPDV RRGNITLEEQ LLILELHSRW GNRWSKIAQH  120
LPGRTDNEIK NYWRTRVQKH AKQLKCDVNS KQFKDTMKYL WMPRLAERIQ AAAASNPATA  180
SSSGPPTTTY IQNQEIQHPL PNMNHHMSDY TPIPFIEKTN SLNYSATSAS SDNYSSDLTD  240
GCYNFPINQS NNQDYSQVNQ STNQMCYGES TINPTNYDFH HGFQGFQEVD QQNNTQWMDN  300
PWNIEDVCFL QQLNNDM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24341392106B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-170HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755171e-170HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573567.10.0PREDICTED: transcription factor MYB108
TrEMBLA0A1U8GQM50.0A0A1U8GQM5_CAPAN; Transcription factor
TrEMBLA0A2G2ZJU70.0A0A2G2ZJU7_CAPAN; transcription factor MYB108
STRINGPGSC0003DMT4000698410.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-84myb domain protein 78