PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g16020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 407aa    MW: 44045 Da    PI: 4.9391
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g16020genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-1685130147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + +W+ eEd+ l ++++++G ++W+ Ia+ ++ gR++k+c++rw + 
       CA05g16020  85 KEPWSREEDLVLMELINKFGARNWSMIAQGIP-GRSGKSCRLRWCNQ 130
                      679*****************************.***********985 PP

2Myb_DNA-binding56.85.2e-18137181147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T eEd ++++a++ +G++ W++Ia+ ++ gRt++ +k++w++ 
       CA05g16020 137 RKPFTDEEDRIIINAHAVHGNK-WASIAKLLP-GRTDNAIKNHWNST 181
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.46980131IPR017930Myb domain
SuperFamilySSF466891.22E-3082178IPR009057Homeodomain-like
SMARTSM007172.3E-1384133IPR001005SANT/Myb domain
PfamPF002494.3E-1585130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2587138IPR009057Homeodomain-like
CDDcd001672.05E-1387129No hitNo description
PROSITE profilePS5129425.807132186IPR017930Myb domain
SMARTSM007173.1E-17136184IPR001005SANT/Myb domain
PfamPF002496.4E-16137181IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-24139185IPR009057Homeodomain-like
CDDcd001673.94E-13139182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MNENAEKSNF SAVAVTAAVE NVSFEGGDAV LHGGGGEGNG GNASVDGGDA VLNGGNGGDD  60
FVDDGGDVEM SESGRGNRVS SGRVKEPWSR EEDLVLMELI NKFGARNWSM IAQGIPGRSG  120
KSCRLRWCNQ LDPLLKRKPF TDEEDRIIIN AHAVHGNKWA SIAKLLPGRT DNAIKNHWNS  180
TLRRRFAELW RVKPLCSVML DDSIDNAKVL FEEIKSHGDF NQIKPLEMLE GSRAECMSSQ  240
SEDKTQIYEI YDIPEKSPNF VSERSCSTSV ENSDPSASRP TEKIGGFYVC NPSATSRIVP  300
MQGPLIHTFS PDFDICKLLE GCVSAGETTV PQGCGYGCCA ASTNSSFKSS LLGPEFVEYE  360
EHPPHLGHEL ASIATDLNNI AWIRSGLEKA GELRNSRHSS TQVGFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-41841856107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573458.10.0PREDICTED: myb-related protein Pp2-like
TrEMBLA0A1U8GXC70.0A0A1U8GXC7_CAPAN; Transcription factor MYB44
TrEMBLA0A2G2ZJN70.0A0A2G2ZJN7_CAPAN; myb-related protein Pp2-like
STRINGPGSC0003DMT4000699210.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26112454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.16e-89myb domain protein 109