PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g15200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 243aa    MW: 27970.7 Da    PI: 9.0571
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g15200genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.11.8e-072564340
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqc 40
                      WT+eE +++  a + +      +W+++a+ ++ g++  ++
       CA05g15200 25 EWTKEENKRFESALAIYDETtpnRWSKVAEIIP-GKSVLDV 64
                     7*****************99*************.*998776 PP

2Myb_DNA-binding41.53e-13122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + +++G+g+W+ I+r +   +t+ q+ s+ qky
       CA05g15200 122 PWTEEEHRRFLMGLEKYGKGDWRNISRNFVISKTPTQVASHAQKY 166
                      8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-41767IPR009057Homeodomain-like
PROSITE profilePS500906.8991872IPR017877Myb-like domain
SMARTSM007172.7E-92274IPR001005SANT/Myb domain
SuperFamilySSF466892.0E-112478IPR009057Homeodomain-like
PfamPF002492.5E-62568IPR001005SANT/Myb domain
CDDcd001672.75E-72572No hitNo description
PROSITE profilePS5129419.357115171IPR017930Myb domain
SuperFamilySSF466891.64E-16116170IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-18118170IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.609.5E-12119166IPR009057Homeodomain-like
SMARTSM007171.2E-11119169IPR001005SANT/Myb domain
CDDcd001673.05E-9122166No hitNo description
PfamPF002492.0E-11122166IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
METLCPTSFV PNSNWTMQQS KSTTEWTKEE NKRFESALAI YDETTPNRWS KVAEIIPGKS  60
VLDVMMQYKE LVADVSDIEA GLVPNPRRFV SSFALEFADH RKIHTFSKRG KSYDQERKKG  120
VPWTEEEHRR FLMGLEKYGK GDWRNISRNF VISKTPTQVA SHAQKYYLRQ LSGEKERKRP  180
SIHDITTVNL TNNELLNNNN KLMCEVKSYM SPLQRSTSPA DVLIGCWNNS FDGDLMAFGQ  240
FV*
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-133HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755171e-133HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573387.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016573388.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-84DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1U8GQ470.0A0A1U8GQ47_CAPAN; transcription factor DIVARICATA-like
TrEMBLA0A1U8GX570.0A0A1U8GX57_CAPAN; Transcription factor DIVARICATA
STRINGPGSC0003DMT4000697531e-150(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.12e-76Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]