PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g13580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 313aa    MW: 35811.3 Da    PI: 9.3958
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g13580genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l +++++ G g+W++ +++ g++R++k+c++rw +yl
       CA05g13580 14 KGPWTPEEDQKLTNYINKNGHGSWRALPKHAGLNRCGKSCRLRWSNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.61.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++ lG++ W++Ia +++ gRt++++k++w+++l
       CA05g13580  67 RGKFSQEEEQTILNLHAVLGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.206961IPR017930Myb domain
SuperFamilySSF466896.97E-3111108IPR009057Homeodomain-like
SMARTSM007178.4E-151363IPR001005SANT/Myb domain
PfamPF002496.7E-171461IPR001005SANT/Myb domain
CDDcd001671.04E-101661No hitNo description
PROSITE profilePS5129427.0762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-2865117IPR009057Homeodomain-like
SMARTSM007171.5E-1666114IPR001005SANT/Myb domain
PfamPF002492.0E-1667112IPR001005SANT/Myb domain
CDDcd001671.24E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLTNYIN KNGHGSWRAL PKHAGLNRCG KSCRLRWSNY  60
LRPDIKRGKF SQEEEQTILN LHAVLGNKWS AIATHLPGRT DNEIKNFWNT HLKKKLIQMG  120
YDPMTHRPRT DIFNSLQHLI ALANLKELIE HNHSWEEQVM RLHYLQNLLQ QPHNNNISTL  180
SAIQNVEANY NLLNSLKDSQ FLDSNSHLGN HIVHQIPSSL DQPIQNSIPF SHLTELHTPC  240
SFQTSLNKDK VPPQDIEFTV MSHEEXCFFV APSFISFSSS SSSTGIKQSK KKRKFFRSGD  300
LILLARRYEG FG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755171e-168HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016574704.10.0PREDICTED: myb-related protein 315-like
SwissprotQ9S9Z21e-94MYB93_ARATH; Transcription factor MYB93
TrEMBLA0A2G2ZJ570.0A0A2G2ZJ57_CAPAN; Transcription factor MYB39
STRINGSolyc05g051550.1.11e-163(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.14e-94myb domain protein 93
Publications ? help Back to Top
  1. Gibbs DJ,Coates JC
    AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis.
    Plant Signal Behav, 2014. 9(10): p. e970406
    [PMID:25482809]