PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g06080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 272aa    MW: 29509.9 Da    PI: 8.9859
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g06080genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.43.9e-091153444
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     W+ e d  + +a + ++ +   +W++Ia  +  g+tl+++k+++
       CA05g06080 11 WSREQDIAFENALATYPEDsadRWEKIAGDVS-GKTLEEVKNHY 53
                     ********************************.**********9 PP

2Myb_DNA-binding44.63.4e-14121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
       CA05g06080 121 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 165
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.1666IPR017884SANT domain
Gene3DG3DSA:1.10.10.609.7E-4757IPR009057Homeodomain-like
SMARTSM007177.5E-7759IPR001005SANT/Myb domain
SuperFamilySSF466892.42E-11965IPR009057Homeodomain-like
PfamPF002497.6E-61153IPR001005SANT/Myb domain
CDDcd001672.44E-71153No hitNo description
PROSITE profilePS5129418.065114170IPR017930Myb domain
SuperFamilySSF466898.22E-17116171IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-18118168IPR006447Myb domain, plants
SMARTSM007175.0E-12118168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-11119164IPR009057Homeodomain-like
CDDcd001679.50E-11121166No hitNo description
PfamPF002493.7E-12121165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MTLAKSRSSI WSREQDIAFE NALATYPEDS ADRWEKIAGD VSGKTLEEVK NHYEILVDDV  60
SRIESGCVPL PCYNSSVDGS SSHGGGERTG KKSGISGRLN GETNDGGKAL RLEQDRRKGV  120
AWTEDEHRLF LLGLEKYGKG DWRSISRNFV VTRTPTQVAS HAQKYFIRLN SMNKDRRRTS  180
IHDITSVKNG DVPVPQVPIT GQTIGAGVAG SSGKSNKHTQ TAPIAPVGVG IYGTTTIGQP  240
VIGQLVNVVG QRQIQDLDIM NSSLGFYYSQ S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-1911921185RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016572400.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ9FNN61e-102SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A1U8GMK30.0A0A1U8GMK3_CAPAN; transcription factor DIVARICATA-like
STRINGPGSC0003DMT4000651021e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41492445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.17e-95MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]