PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g01670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GRAS
Protein Properties Length: 536aa    MW: 59497.4 Da    PI: 6.0317
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g01670genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS398.66.5e-1221665352374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  +lL++ Aeav++ d + a+ lL+ l++++s +g+pmqRl ay++e+L+arl++s+s +yk+l+++e +   sse l+++ ++++++P++kf+++ aN 
  CA05g01670 166 NDLLISSAEAVAEADVTTAEILLSVLEKRVSISGEPMQRLSAYMLEGLRARLLSSGSIIYKKLKCNEPT---SSELLSYMDVLYHICPYFKFAYMSANV 261
                 689*****************************************************************9...9************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                  I ea+++e+r+H+iDf+i qG QW+ +++ La Rp+gpp lRiTgv++++s   +   l+ +gerLa +Ae++gv fef+  +a +  +++le+L+v+
  CA05g01670 262 VIGEAMKNESRIHVIDFQIAQGNQWVFFIHYLARRPGGPPFLRITGVDDSQSAhaRGGGLQLVGERLATIAESCGVLFEFHN-AALSGCQVKLEDLQVR 359
                 *************************************************9988889999***********************.8999************ PP

        GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                 +gE+laVn+ ++lh+++desvs+ ++rd++L+lvkslsPk+v +veqe+++n+++Fl rf e+l+y+ a+f+s+++  pr+++ ri+ E+++++r++vn
  CA05g01670 360 HGESLAVNFPFMLHHMPDESVSTMNHRDRLLRLVKSLSPKIVSLVEQEMNTNTAPFLLRFRETLDYHKAMFESVDVARPRDDKLRISAEEHCIARDVVN 458
                 *************************************************************************************************** PP

        GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 ++acega+r+er+e ++kW++rl++aGF++ pls ++ + ++ +l++++s+ y++ e++g l+lgWk+r+L + SaW+
  CA05g01670 459 LIACEGADRVERQEPFGKWKSRLTMAGFTQCPLSPSVGEAINGMLKEYSSN-YSLAESQGVLYLGWKTRALATSSAWQ 535
                 *************************************************77.*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.387139516IPR005202Transcription factor GRAS
PfamPF035142.3E-119166535IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MGSAHELYHQ PMQQVQQYYT PCRAFDNSIY NDSSSSGTQI SLKTQNEQFF IMDSFPVTDC  60
AIYDAAPSVS VSSNRSPFSP QCSPSCMSEP RRSFENACIS SASGCSGADD GSGKKHVLRE  120
LNNKLLRPEY DIDDSCSCSF DDAVAKSSSL TWRNQVLDVA SRLDLNDLLI SSAEAVAEAD  180
VTTAEILLSV LEKRVSISGE PMQRLSAYML EGLRARLLSS GSIIYKKLKC NEPTSSELLS  240
YMDVLYHICP YFKFAYMSAN VVIGEAMKNE SRIHVIDFQI AQGNQWVFFI HYLARRPGGP  300
PFLRITGVDD SQSAHARGGG LQLVGERLAT IAESCGVLFE FHNAALSGCQ VKLEDLQVRH  360
GESLAVNFPF MLHHMPDESV STMNHRDRLL RLVKSLSPKI VSLVEQEMNT NTAPFLLRFR  420
ETLDYHKAMF ESVDVARPRD DKLRISAEEH CIARDVVNLI ACEGADRVER QEPFGKWKSR  480
LTMAGFTQCP LSPSVGEAIN GMLKEYSSNY SLAESQGVLY LGWKTRALAT SSAWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-5317353427378Protein SCARECROW
5b3h_A3e-5317353426377Protein SCARECROW
5b3h_D3e-5317353426377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016572015.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_016572016.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A2G2XYV90.0A0A2G2XYV9_CAPAN; Scarecrow-like protein 13
STRINGPGSC0003DMT4000605530.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.11e-176SCARECROW-like 13