PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA05g01390 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 132aa MW: 14452.9 Da PI: 9.5461 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 50.8 | 3.8e-16 | 31 | 60 | 26 | 55 |
G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 +AtPk+i+++m+vkgLtl h+kSHLQkYRl CA05g01390 31 EATPKAIMRTMGVKGLTLFHLKSHLQKYRL 60 7****************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 4.3E-7 | 19 | 63 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 9.1E-15 | 27 | 61 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 8.3E-11 | 30 | 61 | IPR006447 | Myb domain, plants |
Pfam | PF14379 | 3.4E-8 | 104 | 125 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MVAQLISAPK SLSLAGIRAF LMHMLSISLA EATPKAIMRT MGVKGLTLFH LKSHLQKYRL 60 GKQSQKDLDE ALKDGLTATY SLESPCSGGT PQQLPASDLN EGFEVKEALR AQMEVQSKLH 120 LQVEVSFLHY R* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ719141 | 3e-53 | AJ719141.1 Nicotiana tabacum cDNA-AFLP-fragment BSTT2-32-460, cultivar Bright Yellow 2. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016571977.1 | 1e-59 | PREDICTED: uncharacterized protein LOC107870086 isoform X1 | ||||
Swissprot | Q94A57 | 8e-28 | PHL2_ARATH; Protein PHR1-LIKE 2 | ||||
TrEMBL | A0A1U8GL36 | 3e-58 | A0A1U8GL36_CAPAN; Myb family transcription factor APL | ||||
TrEMBL | A0A2G2ZFC5 | 3e-58 | A0A2G2ZFC5_CAPAN; uncharacterized protein LOC107870086 isoform X1 | ||||
STRING | Solyc04g015290.2.1 | 3e-58 | (Solanum lycopersicum) | ||||
STRING | PGSC0003DMT400070013 | 3e-58 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA9764 | 20 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24120.1 | 3e-30 | G2-like family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|