PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g19220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 263aa    MW: 29316.5 Da    PI: 8.4507
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g19220genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.4e-193479147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd++l ++v+++G ++W++I++++  gR++k+c++rw + 
       CA04g19220 34 KGPWSAEEDKILTKLVERYGARNWSLISKYIK-GRSGKSCRLRWCNQ 79
                     79*****************************9.***********985 PP

2Myb_DNA-binding56.18.3e-1888130347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
       CA04g19220  88 PFSPSEDETILAAHAKYGNR-WATIARLLP-GRTDNAVKNHWNST 130
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.8362984IPR017930Myb domain
SuperFamilySSF466899.71E-3232127IPR009057Homeodomain-like
SMARTSM007171.1E-163382IPR001005SANT/Myb domain
PfamPF002492.5E-183479IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-253587IPR009057Homeodomain-like
CDDcd001675.42E-153678No hitNo description
SMARTSM007175.4E-1685133IPR001005SANT/Myb domain
PROSITE profilePS5129420.82486135IPR017930Myb domain
CDDcd001673.24E-1288131No hitNo description
PfamPF002495.8E-1588130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2388134IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MDFFNRCSTS TSSSSESSSS ESTPRNDNKA EKIKGPWSAE EDKILTKLVE RYGARNWSLI  60
SKYIKGRSGK SCRLRWCNQL SPNVEHRPFS PSEDETILAA HAKYGNRWAT IARLLPGRTD  120
NAVKNHWNST LKRRYQQLLQ QQNSGQMVNG LEFRSGSGSG SGMEYMNVDE SPKGNTNNYA  180
TTMTTMAQCN YTSGVWRNNN NNYGGGECDD PMTTLSLAPP GMAGEEMPER KTESFPAGFW  240
DVMRDVIAKE VREYVASTGF PN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-40311341104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755163e-49HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571462.10.0PREDICTED: transcription factor MYB44-like
TrEMBLA0A1U8GJJ80.0A0A1U8GJJ8_CAPAN; Transcription factor MYB44
TrEMBLA0A2G2ZRR70.0A0A2G2ZRR7_CAPAN; transcription factor MYB44-like
STRINGSolyc04g079360.1.11e-116(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79502131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.19e-57myb domain protein 77