PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g16680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 331aa    MW: 37347.2 Da    PI: 8.3423
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g16680genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+ +++q G+g +W + ++++g++R++k+c++rw++yl
       CA04g16680 14 RGPWSPEEDAKLKSYIEQNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding361.6e-1170111346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++ eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
       CA04g16680  70 GFSDEEDRIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      699*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.124962IPR017930Myb domain
SuperFamilySSF466891.59E-2511109IPR009057Homeodomain-like
SMARTSM007176.7E-121364IPR001005SANT/Myb domain
PfamPF002494.0E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-241569IPR009057Homeodomain-like
CDDcd001677.72E-91662No hitNo description
PROSITE profilePS5129421.0563117IPR017930Myb domain
SMARTSM007179.0E-1167115IPR001005SANT/Myb domain
PfamPF002496.3E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2270117IPR009057Homeodomain-like
CDDcd001678.04E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRAPCCDKN NVKRGPWSPE EDAKLKSYIE QNGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSDEEDRIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLFGK  120
QRQKQGSRKG KEIKSMSSIS TSNNLNQNPC WPELQPLPYS NNEPRFINND HTSIRKLLIK  180
LGGKFSENDQ LTNVVPNSHE YPIDNSSSMQ LMYQDHINLI SSAPIDHNVF NITAPNIDLY  240
NMDGAASNFT AEFEHMINTS QQKIDGLEFL YENLVIDKFT STSGGNLDWE SMNPYVLPLP  300
PIVASSDGGF QQGVIFQQGA LDELRYPMVQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-24141177108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571495.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y94e-79RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A1U8GK140.0A0A1U8GK14_CAPAN; Transcription factor RAX3
TrEMBLA0A2G2ZR550.0A0A2G2ZR55_CAPAN; transcription factor RAX3-like
TrEMBLA0A2G3CPG60.0A0A2G3CPG6_CAPCH; Transcription factor RAX3
STRINGPGSC0003DMT4000127020.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-78myb domain protein 84
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Guo D, et al.
    The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis.
    Plant Cell, 2015. 27(11): p. 3112-27
    [PMID:26578700]
  3. Pal S, et al.
    TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation.
    Plant Physiol., 2017. 175(2): p. 916-926
    [PMID:28827455]