PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g08580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 333aa    MW: 37570.4 Da    PI: 7.1023
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g08580genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +++ +v+ +G g+W++++++ g++R++k+c++rw +yl
       CA04g08580 14 RGPWTAEEDAKILAYVASHGIGNWTLVPQKAGLNRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding45.32e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T  E+e +++++k  G++ W++Ia++++ gRt++++k++w++
       CA04g08580  68 DNFTSLEEECILELHKTIGSR-WSLIAKRLP-GRTDNDVKNYWNT 110
                      589******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.02965IPR017930Myb domain
SuperFamilySSF466891.64E-3011108IPR009057Homeodomain-like
SMARTSM007179.1E-151363IPR001005SANT/Myb domain
PfamPF002494.5E-161461IPR001005SANT/Myb domain
CDDcd001672.68E-111661No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2365117IPR009057Homeodomain-like
PROSITE profilePS5129416.77266116IPR017930Myb domain
SMARTSM007172.1E-1366114IPR001005SANT/Myb domain
PfamPF002496.9E-1369110IPR001005SANT/Myb domain
CDDcd001679.43E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRPPCCDKA NVKRGPWTAE EDAKILAYVA SHGIGNWTLV PQKAGLNRCG KSCRLRWTNY  60
LRPDLKHDNF TSLEEECILE LHKTIGSRWS LIAKRLPGRT DNDVKNYWNT KLKKKLVNMG  120
IDPVTHKPFA QVFAEYGKIS GLPIQNAKNH IHLPNNTTGK NHVCMESKQF PFSNGTPHDK  180
FVHKIMNDQL QENYTKNYTW DSKETLQTHS SLLISTSTSC NPTVHSYSPS FSSVQSQVHT  240
MPSSTSTCNW NEFIFGDPFT SSGAEQKQET FLSNLLQKEN PTCGEVTEVE EKQPVEEATC  300
SSAMDSFVDT ILANEKQMLM DFPPLLDVYL DY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29141167108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2469623e-68AC246962.1 Solanum lycopersicum chromosome 3 clone FOS0173E02, complete sequence.
GenBankAC2470253e-68AC247025.1 Solanum lycopersicum chromosome 3 clone FOS0173E02, complete sequence.
GenBankHG9755153e-68HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571671.10.0PREDICTED: transcription factor MYB35
TrEMBLA0A1U8GK760.0A0A1U8GK76_CAPAN; Myb-related protein
TrEMBLA0A2G2ZNR50.0A0A2G2ZNR5_CAPAN; transcription factor MYB35
STRINGXP_009764550.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-77MYB family protein