PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA04g06370 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 73aa MW: 8346.78 Da PI: 8.4894 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 49.8 | 8e-16 | 26 | 67 | 53 | 94 |
NF-YB 53 kcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 + r++rkt ngd+l+wal+ lGfedy+eplk yl +yre+ CA04g06370 26 TSIRKRRKTTNGDNLIWALTILGFEDYIEPLKGYLIRYREVI 67 566899**********************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 1.12E-8 | 6 | 67 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 2.1E-10 | 27 | 66 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
MDVEVLVCGL AWDFKCVFCS STRQVTSIRK RRKTTNGDNL IWALTILGFE DYIEPLKGYL 60 IRYREVIAVP PH* |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016572314.1 | 5e-16 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
Refseq | XP_016572315.1 | 5e-16 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
TrEMBL | A0A2G2ZMS7 | 1e-46 | A0A2G2ZMS7_CAPAN; Uncharacterized protein | ||||
STRING | PGSC0003DMT400082465 | 8e-19 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-16 | nuclear factor Y, subunit B3 |