PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g33530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 294aa    MW: 33723.6 Da    PI: 7.2171
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g33530genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-182572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd llv++++ +G g+W+  a++ g++Rt+k+c++rw++yl
       CA03g33530 25 RGPWTIEEDNLLVHYITNHGEGRWNMLAKHAGLKRTGKSCRLRWLNYL 72
                     89********************************************97 PP

2Myb_DNA-binding50.64.3e-1678121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++ +++++ +lG++ W++Ia++++ gRt++++k++w++
       CA03g33530  78 RGNLTPQEQLMILELHSKLGNR-WSKIAHYLP-GRTDNEIKNYWRT 121
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.2972076IPR017930Myb domain
SuperFamilySSF466892.21E-3123119IPR009057Homeodomain-like
SMARTSM007179.0E-142474IPR001005SANT/Myb domain
PfamPF002495.4E-162572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-232679IPR009057Homeodomain-like
CDDcd001672.82E-112772No hitNo description
SMARTSM007177.3E-1577125IPR001005SANT/Myb domain
PROSITE profilePS5129420.2177127IPR017930Myb domain
PfamPF002496.1E-1578121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2380126IPR009057Homeodomain-like
CDDcd001671.73E-1182121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
METDMSFLSK TSSSSSSDDD IELRRGPWTI EEDNLLVHYI TNHGEGRWNM LAKHAGLKRT  60
GKSCRLRWLN YLKPDVKRGN LTPQEQLMIL ELHSKLGNRW SKIAHYLPGR TDNEIKNYWR  120
TRVQKQARNL KIDANSAAFQ EMIRYLWIPR LLQKIQSSSS VMPSIQSPQS TPQGFNIEKN  180
STNTSRCSSC SSSHSSNIYN STNIMSECPK IPPRDIGDSD LNSFVKAHFP VDDNSYDVDN  240
YGQLATGNYY NDVMDYDQMS GDQNKLTGDV LSDSFWSNMD EFFYQKQDMS HCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-28221271105MYB PROTO-ONCOGENE PROTEIN
1h8a_C5e-282212724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor of phosphate (Pi) starvation-induced genes. Regulates negatively Pi starvation responses via the repression of gibberellic acid (GA) biosynthesis and signaling. Modulates root architecture, phosphatase activity, and Pi uptake and accumulation. {ECO:0000269|PubMed:19529828}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by salicylic acid (PubMed:16463103). Induced reversibly in response to phosphate (Pi) deficiency but repressed in the presence of Pi, specifically in the leaves. Availability of Pi increases with decreased levels (PubMed:19529828). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19529828}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755151e-69HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016563145.10.0PREDICTED: myb-related protein 340-like
SwissprotQ9C9G71e-76MYB62_ARATH; Transcription factor MYB62
TrEMBLA0A2G3A3770.0A0A2G3A377_CAPAN; Transcription factor
STRINGPGSC0003DMT4000143831e-150(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.19e-74myb domain protein 62
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]