PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g30090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 335aa    MW: 36719.9 Da    PI: 6.6782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g30090genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W++++   g+ R+ k+c++rw +yl
       CA03g30090 14 KGPWTPEEDIILVSYIQQHGPGNWRAVPGNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.59.7e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
       CA03g30090  67 RGNFTEHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.197961IPR017930Myb domain
SuperFamilySSF466891.98E-3011108IPR009057Homeodomain-like
SMARTSM007176.5E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001674.31E-111661No hitNo description
PROSITE profilePS5129423.88862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2465117IPR009057Homeodomain-like
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PfamPF002492.5E-1467112IPR001005SANT/Myb domain
CDDcd001672.57E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0010468Biological Processregulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRPPCCDKI GVKKGPWTPE EDIILVSYIQ QHGPGNWRAV PGNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLRKKLKKIQ  120
GNDENSTGQE GATSSSSQSN FIKGQWERRL QTDIHMAKKA LVEALSLDKS DSLANPISPV  180
LAQQTVPGSS SYASSAENIS RLLQNWMKNS PKSSQLSRSN SETTQSSFNN PSIGSGSGSS  240
SSPSEGTISG ATPEGFDALF SEGNAFTPEN SAIFQVESKL NFQNINSENG ILFQEESQAP  300
LTLLEKWLFD DAINAPTQGD EFIGMDLGES AGFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-26141164105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h8a_C6e-261411627128MYB TRANSFORMING PROTEIN
1mse_C3e-26141164105C-Myb DNA-Binding Domain
1msf_C3e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAPTransfer from AT5G62470Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016563223.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-131MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A1U8G3F60.0A0A1U8G3F6_CAPAN; Myb-related protein
TrEMBLA0A2G3A2B30.0A0A2G3A2B3_CAPAN; myb-related protein 306
STRINGPGSC0003DMT4000502870.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-108myb domain protein 96
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]