PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g27000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 373aa    MW: 42881.8 Da    PI: 5.8861
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g27000genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.4e-18172218148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd +l+++v+++G + W+ Ia+++  gR +kqc++rw+++l
       CA03g27000 172 KGQWTIEEDRILINLVEKFGDRKWSEIAKMLK-GRIGKQCRERWNNHL 218
                      799****************************9.*************97 PP

2Myb_DNA-binding52.89e-17226266345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd +l++a+++ G++ W+ Ia+++  gRt++++k++w+
       CA03g27000 226 LWTEEEDRILIEAHAEIGNK-WAEIAKRLT-GRTENSIKNHWN 266
                      6*******************.********9.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.204167222IPR017930Myb domain
SMARTSM007178.8E-16171220IPR001005SANT/Myb domain
PfamPF002494.7E-17172218IPR001005SANT/Myb domain
SuperFamilySSF466891.26E-30172265IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27173226IPR009057Homeodomain-like
CDDcd001671.14E-14175218No hitNo description
PROSITE profilePS5129421.004223273IPR017930Myb domain
SMARTSM007176.2E-16223271IPR001005SANT/Myb domain
PfamPF002491.6E-15226266IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-21227272IPR009057Homeodomain-like
CDDcd001672.52E-12227269No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MDFDPSSKQD VFCTIPTDYL HDFHHLDLTF SLAGGPLTFN TNPDHMIEMD SGYEHPLFDP  60
LSNHGDNFSS MGQDFNFGYE FKPFEQNGNA SGSTLFMKNF ESSTDMKSIN FNVVRDESSC  120
VTSTIENNGT NNVYNDKEIG GRKNKKLIKS NDSSSSMRKS GRGTRKKSKS AKGQWTIEED  180
RILINLVEKF GDRKWSEIAK MLKGRIGKQC RERWNNHLRP DIKKDLWTEE EDRILIEAHA  240
EIGNKWAEIA KRLTGRTENS IKNHWNATKR RQFTRRKCRT KWCSPSSILQ NYIKSLNFEK  300
GNNNSAPKIE PIDQQVPADN YDFGEFDLED KLFDDLENVP NYCELAQLIM QDGEVNKEVD  360
LMDFISPNPE NV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-441722724104C-Myb DNA-Binding Domain
1msf_C4e-441722724104C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU1247372e-75EU124737.2 Solanum lycopersicum chromosome 3 clone C03HBa0054O21, complete sequence.
GenBankHG9754422e-75HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755152e-75HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016567636.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L27e-69MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A1U8G8H90.0A0A1U8G8H9_CAPAN; Transcription factor MYB98
TrEMBLA0A2G3A1F50.0A0A2G3A1F5_CAPAN; transcription factor MYB98-like
STRINGPGSC0003DMT4000466001e-177(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-66myb domain protein 98
Publications ? help Back to Top
  1. Mendes MA, et al.
    Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis.
    Development, 2016. 143(15): p. 2780-90
    [PMID:27338615]