PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA03g26510 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 109aa MW: 13047 Da PI: 10.4738 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 26.6 | 1e-08 | 53 | 87 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 + +yp++ ++ LA+++gL+ +q+ +WF N+R ++ CA03g26510 53 NWPYPTEVDKVFLAESTGLDPKQINNWFINQRKRH 87 569*****************************985 PP | |||||||
2 | ELK | 24.7 | 5.5e-09 | 7 | 28 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 E+K+ L+ KYsgy+ sLk+ F+ CA03g26510 7 EIKDKLMGKYSGYITSLKHNFC 28 89****************9887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 8.748 | 7 | 27 | IPR005539 | ELK domain |
Pfam | PF03789 | 1.9E-7 | 7 | 28 | IPR005539 | ELK domain |
SMART | SM01188 | 2.4E-4 | 7 | 28 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 11.11 | 27 | 90 | IPR001356 | Homeobox domain |
SMART | SM00389 | 4.1E-11 | 29 | 94 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.57E-19 | 29 | 100 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.67E-10 | 30 | 91 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.5E-27 | 33 | 92 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 4.7E-17 | 47 | 86 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 65 | 88 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 109 aa Download sequence Send to blast |
MCRRRSEIKD KLMGKYSGYI TSLKHNFCKK NNKGKLPREA TKILFNWWNT HYNWPYPTEV 60 DKVFLAESTG LDPKQINNWF INQRKRHWKP SENMQFAVME TIHGHFSQ* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB025713 | 4e-92 | AB025713.1 Nicotiana tabacum mRNA for homeobox 9, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019244737.1 | 5e-60 | PREDICTED: homeobox protein knotted-1-like 2 | ||||
Swissprot | Q84JS6 | 5e-41 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A2G2XZ36 | 6e-77 | A0A2G2XZ36_CAPAN; Uncharacterized protein | ||||
STRING | XP_009618137.1 | 1e-58 | (Nicotiana tomentosiformis) | ||||
STRING | PGSC0003DMT400087440 | 9e-59 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA753 | 24 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 2e-43 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|