PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA03g20530 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 136aa MW: 16297 Da PI: 10.5541 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 58.9 | 8.3e-19 | 26 | 76 | 6 | 56 |
S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +ft+eq++ Le++F+ ++ +e+ +LA+ lgL+ rqV +WFqN+Ra++k CA03g20530 26 RFTDEQVKLLESMFKLGTKIEPREKLQLARDLGLQPRQVAIWFQNKRARWK 76 7*************************************************9 PP | |||||||
2 | HD-ZIP_I/II | 116 | 2.2e-37 | 24 | 112 | 3 | 91 |
HD-ZIP_I/II 3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 +r+++eqvklLE++F+ +k+ep++K +lar+Lglqprqva+WFqn+RAR+k+kqlE++y+ L++++d+l+++ e+L+ e+e+L e+ CA03g20530 24 AKRFTDEQVKLLESMFKLGTKIEPREKLQLARDLGLQPRQVAIWFQNKRARWKSKQLEHEYRILQSKFDHLNTQFESLKIEKERLLIEV 112 69*********************************************************************************998665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.14E-18 | 14 | 80 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.568 | 18 | 78 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.2E-16 | 20 | 82 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 4.1E-20 | 25 | 85 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 2.8E-16 | 26 | 76 | IPR001356 | Homeobox domain |
CDD | cd00086 | 3.35E-12 | 26 | 79 | No hit | No description |
PRINTS | PR00031 | 4.5E-6 | 49 | 58 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 53 | 76 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 4.5E-6 | 58 | 74 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 9.7E-12 | 78 | 112 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MESEHEKSET PNFKRPLKKK CENAKRFTDE QVKLLESMFK LGTKIEPREK LQLARDLGLQ 60 PRQVAIWFQN KRARWKSKQL EHEYRILQSK FDHLNTQFES LKIEKERLLI EVTFSLSLFA 120 SDILRWFILT SFARK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY368484 | 0.0 | AY368484.1 Capsicum annuum HD-ZIP (HD-Zip) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001311778.1 | 6e-74 | homeobox-leucine zipper protein ATHB-12-like | ||||
Swissprot | P46897 | 4e-36 | ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7 | ||||
TrEMBL | A0A2G3A038 | 1e-72 | A0A2G3A038_CAPAN; Homeobox-leucine zipper protein HOX6 | ||||
STRING | PGSC0003DMT400047622 | 6e-60 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2041 | 23 | 63 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46680.1 | 2e-38 | homeobox 7 |
Publications ? help Back to Top | |||
---|---|---|---|
|