PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g14200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 234aa    MW: 27006.6 Da    PI: 9.7821
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g14200genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.11.1e-141764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++l  ++ ++G  +W+  ++  g+ Rt+k+c++rw +yl
       CA03g14200 17 KGAWSPEEDQKLRTYIMRYGIWNWRQMPKFAGLSRTGKSCRLRWMNYL 64
                     79******************99************************97 PP

2Myb_DNA-binding361.6e-1170115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE e  ++  ++l ++ W++Ia +++ gRt+ ++k++++++l
       CA03g14200  70 RGPFTMEEVETVIKTYQKLRSR-WSAIATKLP-GRTDTEVKNFFHTHL 115
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.5071268IPR017930Myb domain
SuperFamilySSF466892.81E-2715111IPR009057Homeodomain-like
SMARTSM007172.3E-121666IPR001005SANT/Myb domain
PfamPF002492.6E-131764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-221871IPR009057Homeodomain-like
CDDcd001674.58E-101964No hitNo description
PROSITE profilePS5129413.80569119IPR017930Myb domain
SMARTSM007174.4E-969117IPR001005SANT/Myb domain
PfamPF002493.5E-1070115IPR001005SANT/Myb domain
CDDcd001674.11E-672115No hitNo description
Gene3DG3DSA:1.10.10.606.2E-2172119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MLRVPQQQQQ KGTTIKKGAW SPEEDQKLRT YIMRYGIWNW RQMPKFAGLS RTGKSCRLRW  60
MNYLHPDVKR GPFTMEEVET VIKTYQKLRS RWSAIATKLP GRTDTEVKNF FHTHLKKHLG  120
LKNYDAQLKT RKGHKQTQEN EKENSTQGRL VLETINSSSS LSPDVCSPCS STITCKENQM  180
TDQFTNFSLL VDQQVSEGEN TNIQPCFIPG GSTFSTFDQF DMNSFWFDVL GNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-201511725126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016553116.11e-177PREDICTED: myb-related protein Myb4-like
TrEMBLA0A1U8F3981e-175A0A1U8F398_CAPAN; Transcription factor MYB34
TrEMBLA0A2G2ZWL21e-175A0A2G2ZWL2_CAPAN; myb-related protein Myb4-like
STRINGPGSC0003DMT4000214981e-123(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.17e-47myb domain protein 14