PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g30450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 256aa    MW: 29406 Da    PI: 6.3071
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g30450genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding452.5e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +lv+ +   G  +W+t+++  g+ R++k+c++rw +yl
       CA02g30450 14 RGPWTIEEDHKLVHFILSNGIQCWRTVPKLAGLQRCGKSCRLRWINYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.81.8e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++ E++++++++++lG++ W++Ia++++ gRt++++k++w++
       CA02g30450  67 RGALSEAEEDQIIQLHARLGNR-WSKIASYFP-GRTDNEIKNHWNT 110
                      78889*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-20564IPR009057Homeodomain-like
PROSITE profilePS5129415.813961IPR017930Myb domain
SuperFamilySSF466891.42E-2811108IPR009057Homeodomain-like
SMARTSM007179.9E-71363IPR001005SANT/Myb domain
PfamPF002495.6E-121461IPR001005SANT/Myb domain
CDDcd001672.04E-51661No hitNo description
PROSITE profilePS5129426.0862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2465116IPR009057Homeodomain-like
SMARTSM007172.7E-1566114IPR001005SANT/Myb domain
PfamPF002493.0E-1567110IPR001005SANT/Myb domain
CDDcd001674.42E-1171110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRQPCCDRV GLKRGPWTIE EDHKLVHFIL SNGIQCWRTV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAL SEAEEDQIIQ LHARLGNRWS KIASYFPGRT DNEIKNHWNT RIKKRLQLMG  120
IDPLTHQPID MEKYQHEPDQ TEKCDKRNEP ENFIENTNDV SLPNNPHHNM LSDSFNVDLW  180
NKSGNTMSTC YSPSISLEAE ESINLSTTTS AATESSSNVA ALTEEQDSLQ QWMDSIFSCA  240
VNQLEEDLIF LRKYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269|PubMed:23660402}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269|PubMed:23660402}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016561662.10.0PREDICTED: myb-related protein 315-like
SwissprotQ9C7U73e-73MYB20_ARATH; Transcription factor MYB20
TrEMBLA0A1U8FR140.0A0A1U8FR14_CAPAN; Protein ODORANT1
TrEMBLA0A2G3ACM20.0A0A2G3ACM2_CAPAN; myb-related protein 315-like
TrEMBLA0A2G3DA200.0A0A2G3DA20_CAPCH; Protein ODORANT1
STRINGXP_009593357.11e-154(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.12e-80myb domain protein 40
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]