PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g28250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 306aa    MW: 34400.4 Da    PI: 7.3365
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g28250genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv  v+++G+g+W+t++ +   ++R+ k+c++rw +yl
       CA02g28250 14 KGPWTPEEDIMLVSFVQEHGPGNWRTVPTHTAgLRRCSKSCRLRWTNYL 62
                     79****************************999**************97 PP

2Myb_DNA-binding48.71.7e-1568113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
       CA02g28250  68 RGSFTDQEEKMIIQLQALLGNK-WAAIASYLP-ERTDNDIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-24565IPR009057Homeodomain-like
PROSITE profilePS5129417.96962IPR017930Myb domain
SuperFamilySSF466891.32E-3011109IPR009057Homeodomain-like
SMARTSM007171.9E-141364IPR001005SANT/Myb domain
PfamPF002491.7E-151462IPR001005SANT/Myb domain
CDDcd001674.29E-111662No hitNo description
PROSITE profilePS5129424.58463117IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2566118IPR009057Homeodomain-like
SMARTSM007178.3E-1667115IPR001005SANT/Myb domain
PfamPF002499.8E-1568113IPR001005SANT/Myb domain
CDDcd001672.01E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGRPPCCDKL GVKKGPWTPE EDIMLVSFVQ EHGPGNWRTV PTHTAGLRRC SKSCRLRWTN  60
YLRPGIKRGS FTDQEEKMII QLQALLGNKW AAIASYLPER TDNDIKNYWN THLKKKLKKL  120
EANDLYSSDG HCLSSIKSAS RGQWERTLQA DINTAKQALQ NALSLDKSSP ISEYTIKPIN  180
IDCYPSYIKQ EAKMSTSTYA SSAENIAKLL KQWTRSDSTN NSEQSKASSS TQFSCNTTNN  240
TNAMTEYSSS FESFEPSNSD QFSQATTPEA AGKFYGESKR ELDNEVPLSV MLESWLFDEN  300
DDLLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-30141174105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-291411758159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-291411758159MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-30141174105C-Myb DNA-Binding Domain
1msf_C5e-30141174105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016562275.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-103MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A2G3ACC60.0A0A2G3ACC6_CAPAN; Myb-related protein
STRINGSolyc02g087960.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-100myb domain protein 94
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]