PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g28060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 416aa    MW: 45202.9 Da    PI: 5.827
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g28060genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
       CA02g28060 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.13.6e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
       CA02g28060  67 RGKFTLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.5E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.914961IPR017930Myb domain
SuperFamilySSF466896.97E-3111108IPR009057Homeodomain-like
SMARTSM007172.6E-141363IPR001005SANT/Myb domain
PfamPF002491.4E-161461IPR001005SANT/Myb domain
CDDcd001672.00E-111661No hitNo description
PROSITE profilePS5129426.33362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2665117IPR009057Homeodomain-like
SMARTSM007175.8E-1766114IPR001005SANT/Myb domain
PfamPF002492.3E-1667112IPR001005SANT/Myb domain
CDDcd001679.52E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF TLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLVKMG  120
IDPVTHKPKN DALLSNDGQS KNAANLSHMA QWESARLEAE ARLARQSKLR SSSFHSSITS  180
QEFTAPSPSS PLSKPVVGPT RCLDVLKAWN GVWTKPMNDV SVANASAGIS VTGLARDLES  240
PTSTLGYFEN AQHISTSGIG GNSTILYEFV GNSSGSSEGG IMNNEESEED WKGFGNSSTG  300
HLPEYNKDGI NENSLSFTSG LQDLTLPMDT TWTAESLRSN TDQISPANFV ETFTDLLLSN  360
SGDGDLSEGG GTESDNGGEG SGSGNASENC EDNKNYWNSI FNLVNNPSPS DSAMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269|PubMed:17376813, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016561384.10.0PREDICTED: myb-related protein Hv1-like
SwissprotQ9LXF11e-123MYB16_ARATH; Transcription factor MYB16
TrEMBLA0A1U8G0840.0A0A1U8G084_CAPAN; Transcription factor MYB39
TrEMBLA0A2G2V9A20.0A0A2G2V9A2_CAPBA; Transcription factor MYB39
TrEMBLA0A2G3ACJ30.0A0A2G3ACJ3_CAPAN; myb-related protein Hv1-like
STRINGPGSC0003DMT4000033820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-106myb domain protein 16
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Huang BH, et al.
    Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae).
    Int J Mol Sci, 2015. 16(3): p. 5900-21
    [PMID:25782156]
  4. Cui F, et al.
    Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation.
    Mol Plant, 2016. 9(6): p. 926-38
    [PMID:27060495]