PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g27040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 258aa    MW: 29489.4 Da    PI: 8.9401
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g27040genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding65.21.2e-201865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ l ++vk++G g+W+++ar+ g++Rt+k+c++rw +yl
       CA02g27040 18 KGPWTPEEDKMLSEYVKLHGEGRWSSVARCAGLNRTGKSCRLRWVNYL 65
                     79********************************************97 PP

2Myb_DNA-binding51.32.6e-1671115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ +++++++++G++ W+tIar+++ gRt++++k++w+++
       CA02g27040  71 RGHITPQEEGIIIELHALWGNK-WSTIARYLP-GRTDNEIKNYWRTH 115
                      6778******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1481365IPR017930Myb domain
SuperFamilySSF466891.76E-3215112IPR009057Homeodomain-like
SMARTSM007176.0E-181767IPR001005SANT/Myb domain
PfamPF002496.2E-191865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-241972IPR009057Homeodomain-like
CDDcd001671.52E-132065No hitNo description
PROSITE profilePS5129424.89266120IPR017930Myb domain
SMARTSM007172.3E-1470118IPR001005SANT/Myb domain
PfamPF002493.7E-1471115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2473119IPR009057Homeodomain-like
CDDcd001675.04E-1075116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MVAMMGWGAN SDQQGWRKGP WTPEEDKMLS EYVKLHGEGR WSSVARCAGL NRTGKSCRLR  60
WVNYLRPGLK RGHITPQEEG IIIELHALWG NKWSTIARYL PGRTDNEIKN YWRTHFKKKE  120
KASGKQDKRK IIRQKNQPQP NCTIATIDKK LSPQAEEVVI MKSDDSNAYT NYYHKNIMDQ  180
DPVVELPPVT TCSDTSYAWT DTFLMDGFWG GLWNLDDHSL MQATNDKCKV ANIQNQPANC  240
TYATDYAVNL HNGGFIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25181197107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-41HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016562250.10.0PREDICTED: myb-related protein 340
TrEMBLA0A2G3ABN20.0A0A2G3ABN2_CAPAN; Transcription factor MYB24
STRINGXP_009610111.11e-128(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.11e-78myb domain protein 121