PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g24700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 331aa    MW: 37441.8 Da    PI: 7.2328
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g24700genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.9e-181462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+ +++q+G+g +W t ++++g++R++k+c++rw++yl
       CA02g24700 14 RGPWSPEEDSKLKAYIEQHGTGgNWITLPQKVGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding38.92e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
       CA02g24700  69 GEFTDEEDNIICTLYMSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.976962IPR017930Myb domain
SuperFamilySSF466894.05E-2711109IPR009057Homeodomain-like
SMARTSM007174.6E-131364IPR001005SANT/Myb domain
PfamPF002498.5E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-251569IPR009057Homeodomain-like
CDDcd001674.98E-101662No hitNo description
PROSITE profilePS5129421.84263117IPR017930Myb domain
SMARTSM007175.1E-1267115IPR001005SANT/Myb domain
PfamPF002494.7E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-2470117IPR009057Homeodomain-like
CDDcd001672.27E-870111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDSKLKAYIE QHGTGGNWIT LPQKVGLKRC GKSCRLRWLN  60
YLRPNIKHGE FTDEEDNIIC TLYMSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLLC  120
NKQRKDHRPR TGYNHNKVDM MKEQEDFFAT HQTTNNAYSW SPQQILFSTL IAPQNHDLAE  180
CSANSHNFQY SSTDQAYFSQ DQLCQISSTN HLASMNPVNG STCNSSMMVS SGAYYPSNGV  240
CNNGLQEYNN YISVGLDHDV LNSTSTAHSQ QVDKSVLEMV NSSTISTTSQ DQSTSWEELS  300
PLVNYPPSVF ETVSPYYVFE EPRYLGLLKQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141177108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016562190.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y99e-79RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A1U8FTP00.0A0A1U8FTP0_CAPAN; Transcription factor MYB39
TrEMBLA0A2G3AB330.0A0A2G3AB33_CAPAN; transcription factor RAX3-like
STRINGPGSC0003DMT4000551480.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.14e-80myb domain protein 84
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Guo D, et al.
    The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis.
    Plant Cell, 2015. 27(11): p. 3112-27
    [PMID:26578700]
  3. Pal S, et al.
    TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation.
    Plant Physiol., 2017. 175(2): p. 916-926
    [PMID:28827455]