PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g19560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 342aa    MW: 38724.5 Da    PI: 7.1656
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g19560genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++ ++ +G  +W+++++  g+ R++k+c++rw +yl
       CA02g19560 13 RGLWSPEEDEKLIKHITTHGHSCWSSVPKLAGLQRCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding50.93.5e-1666109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E+ +++d+++ lG++ W+ Ia++++ gRt++++k++w++
       CA02g19560  66 RGCFSEQEERIIIDVHRILGNK-WAQIAKHLP-GRTDNEVKNFWNS 109
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-25463IPR009057Homeodomain-like
PROSITE profilePS5129417.251860IPR017930Myb domain
SuperFamilySSF466894.49E-2810107IPR009057Homeodomain-like
SMARTSM007179.0E-131262IPR001005SANT/Myb domain
PfamPF002497.3E-151360IPR001005SANT/Myb domain
CDDcd001671.07E-101660No hitNo description
PROSITE profilePS5129426.07461115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2464116IPR009057Homeodomain-like
SMARTSM007174.8E-1565113IPR001005SANT/Myb domain
PfamPF002491.0E-1466109IPR001005SANT/Myb domain
CDDcd001677.48E-1169108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLIKHITT HGHSCWSSVP KLAGLQRCGK SCRLRWINYL  60
RPDLKRGCFS EQEERIIIDV HRILGNKWAQ IAKHLPGRTD NEVKNFWNSC IKKKLISQGF  120
DPNTHNLLSR AAAAAATPPH RNNKKKTNNN HTTSSVFTIE TSLSPSSTKE LVSMDMIKAS  180
LAALSPFPHT NSSTTVLTMP QFQTSWSHLY ESACNYYNHV PIKTNIVYQN HSTSTGTFGI  240
INENCMWGVT GFEPHHEFGP SNNIGHEEMQ QGAQVQLQEE HCLEEVYKVN DLHEFNKHGR  300
IAENVTFDDS SDFDFEFVDS ELIPCGIYTN VNSIDQLAWD C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30131157108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4779560.0AF477956.1 Capsicum annuum transcription factor Myb mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001311738.10.0protein ODORANT1-like
TrEMBLA0A2G3A9F90.0A0A2G3A9F9_CAPAN; Transcription factor MYB26
STRINGPGSC0003DMT4000188971e-180(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.14e-83myb domain protein 67