PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g16960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 382aa    MW: 43313.1 Da    PI: 6.093
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g16960genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.3e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
       CA02g16960 14 KGPWTPEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.42.9e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
       CA02g16960  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-27564IPR009057Homeodomain-like
PROSITE profilePS5129425.649965IPR017930Myb domain
SuperFamilySSF466893.18E-3211108IPR009057Homeodomain-like
SMARTSM007174.9E-141363IPR001005SANT/Myb domain
PfamPF002494.1E-171461IPR001005SANT/Myb domain
CDDcd001674.20E-131661No hitNo description
Gene3DG3DSA:1.10.10.602.5E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.4666116IPR017930Myb domain
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1567111IPR001005SANT/Myb domain
CDDcd001672.62E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTPE EDQKLIDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDLSSILN PSFYNNSSSL HQMNLSRLLG HVQPLVNPEV LRLATSLLSS  180
QRQNTNNSFM IPNNHQENQI CQNQLPQMVQ NSQIQAPIQD YPTCTTLSTT PCVPFSSHEA  240
QLMQPPTTNM EGFSSKLENF SNSTSCQVND EWQLSNGMPT SNLTDDYFPL QNYGYYDPLP  300
SDGSTLIQSN DSNNNNNFSF QSTVLSNLST PSSSPTPLDS NSTYFNNSSS TTTEDERDSY  360
CSNMLNFDNI PNIWDTTNEF M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-141HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016562074.10.0PREDICTED: protein ODORANT1-like
SwissprotQ9LDR81e-116MY102_ARATH; Transcription factor MYB102
TrEMBLA0A1U8G2720.0A0A1U8G272_CAPAN; Transcription factor MYB39
TrEMBLA0A2G3A8Z00.0A0A2G3A8Z0_CAPAN; protein ODORANT1-like
TrEMBLA0A2G3D6130.0A0A2G3D613_CAPCH; Transcription factor MYB39
STRINGPGSC0003DMT4000576900.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-114MYB-like 102
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]
  4. Zhu L,Guo J,Ma Z,Wang J,Zhou C
    Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis.
    Biomolecules, 2019.
    [PMID:29880735]