PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g14840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 357aa    MW: 39443.4 Da    PI: 8.7463
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g14840genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.61.8e-201661147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEdell ++v+++G+++W++I++ ++ gR++k+c++rw + 
       CA02g14840 16 KGPWSPEEDELLQQLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 61
                     79******************************.***********985 PP

2Myb_DNA-binding574.4e-1870112347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a++++G++ W+tIar ++ gRt++ +k++w++ 
       CA02g14840  70 AFTPEEDETIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 112
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.761166IPR017930Myb domain
SuperFamilySSF466891.19E-3213109IPR009057Homeodomain-like
SMARTSM007175.7E-181564IPR001005SANT/Myb domain
PfamPF002493.5E-201661IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-271769IPR009057Homeodomain-like
CDDcd001673.15E-171860No hitNo description
SMARTSM007173.8E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129421.46768117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2370116IPR009057Homeodomain-like
CDDcd001672.35E-1270113No hitNo description
PfamPF002491.4E-1570112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MANTSNSSKR DMDRVKGPWS PEEDELLQQL VQKHGPRNWS LISKSIPGRS GKSCRLRWCN  60
QLSPQVEHRA FTPEEDETII RAHARFGNKW ATIARLLNGR TDNAIKNHWN STLKRKCCSL  120
SADEGKELAD QIFENHQPPL KRSVSAGSAM PVSGFHFSPG SPSGSDSDSS LHVTSSSQSH  180
VFKPVAKTGG IFPPPSIDIS SPSIDPPTSL SLSLPGADLA ELSSRSAEST QSKNPFQLSL  240
PPPVQVPPPP PPPPPPPQPQ PVTAVPFEQQ DKIFVPFSQE LLRVMQEMIK TEVRNYMMGI  300
EQKQQHPQQQ HYQQQQQFQQ QTHQLPSGLG LGLCMQQASD GYRDRAANRM GISKFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-40151163104C-Myb DNA-Binding Domain
1msf_C4e-40151163104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF2220250.0EF222025.1 Capsicum annuum MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001311714.10.0transcription factor MYB44-like
TrEMBLA0A1U8FP430.0A0A1U8FP43_CAPAN; transcription factor MYB44-like
STRINGXP_009798591.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-76myb domain protein r1