PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g08640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 331aa    MW: 36935.2 Da    PI: 5.288
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g08640genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +v+++G+g+W++++ + g++R+ k+c++rw +yl
       CA02g08640 14 KGPWTPEEDIMLVSYVQEHGPGNWRAVPTKTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.81.6e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ ++++ +++G++ W++Ia++++  Rt++++k++w+++l
       CA02g08640  67 RGNFTDQEEKTIIQLQALFGNK-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.873965IPR017930Myb domain
SuperFamilySSF466896.24E-3111108IPR009057Homeodomain-like
SMARTSM007175.6E-151363IPR001005SANT/Myb domain
PfamPF002496.3E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-241568IPR009057Homeodomain-like
CDDcd001672.53E-111661No hitNo description
PROSITE profilePS5129420.00466116IPR017930Myb domain
SMARTSM007177.4E-1666114IPR001005SANT/Myb domain
PfamPF002499.1E-1567112IPR001005SANT/Myb domain
CDDcd001671.18E-1069111No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2569117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRLPCCDKV GVKKGPWTPE EDIMLVSYVQ EHGPGNWRAV PTKTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKTIIQ LQALFGNKWA AIASYLPERT DNDIKNYWNT HLKKKLKKFQ  120
LDQCSGSDDH LFYVENGLTH LSSSNSRGQW ERTLQTDINM AKKALHNALS LENSTSPLIN  180
IKQENPQVSS STYASSTENI SRLLQGWMRS STSENSKTSS NNIATTDSSS CDGTPNAESK  240
GGMGLMEAFE SLFGLESFES SSSDEFSQTT SPQAEATKVE IKKEENENVE APAVPLSIIL  300
ENWLLDENTL NIQAKDDLTT FSFDEIAPLF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to the promoters of genes involved in cuticular wax biosynthesis. Transactivates WSD1, KCS2/DAISY, CER1, CER2, FAR3 and ECR genes (PubMed:25305760, PubMed:27577115). Functions together with MYB96 in the activation of cuticular wax biosynthesis (PubMed:27577115). {ECO:0000269|PubMed:25305760, ECO:0000269|PubMed:27577115}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress, osmotic shock and abscisic acid (ABA). {ECO:0000269|PubMed:25305760}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX991340.0X99134.1 L.esculentum mRNA for myb-related transcription factor, THM6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016559048.10.0PREDICTED: myb-related protein 306-like
SwissprotQ9SN781e-101MYB94_ARATH; Transcription factor MYB94
TrEMBLA0A2G3A6490.0A0A2G3A649_CAPAN; Myb-related protein
STRINGXP_009765566.11e-180(Nicotiana sylvestris)
STRINGXP_009629125.11e-180(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.14e-95myb domain protein 94
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Cui F, et al.
    Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation.
    Mol Plant, 2016. 9(6): p. 926-38
    [PMID:27060495]
  4. Lee SB,Kim HU,Suh MC
    MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.
    Plant Cell Physiol., 2016. 57(11): p. 2300-2311
    [PMID:27577115]