PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA02g08630 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 81aa MW: 8847.59 Da PI: 8.904 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 62.3 | 9.8e-20 | 29 | 64 | 3 | 38 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegta 38 +vrYkeC+kNhAas+Gg+avDGC+Efmps +e +++ CA02g08630 29 RVRYKECQKNHAASVGGYAVDGCREFMPSGDEGTDS 64 79**************************95554554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 1.0E-12 | 1 | 62 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 2.9E-17 | 30 | 64 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.4E-15 | 31 | 63 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 17.63 | 32 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
MRKIQVVVKR DDDSASSQSS TNSAFTVRRV RYKECQKNHA ASVGGYAVDG CREFMPSGDE 60 GTDSXCLWLS PQFPPKRSGN * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016559051.1 | 4e-40 | PREDICTED: mini zinc finger protein 2 | ||||
Swissprot | Q9LJW5 | 7e-18 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A2G3A600 | 4e-52 | A0A2G3A600_CAPAN; Mini zinc finger protein 2 | ||||
STRING | Solyc02g067330.1.1 | 2e-29 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1105 | 24 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 1e-18 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|