PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g02750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 296aa    MW: 31829.3 Da    PI: 7.0887
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g02750genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.15.3e-101153444
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     W+ e d+ + +a + ++ +   +W++Ia  ++  +tl+++k+++
       CA02g02750 11 WSREQDKAFENALATYPEDsadRWEKIATDVP-EKTLEEVKHHY 53
                     ********************************.9*********9 PP

2Myb_DNA-binding422.2e-13121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
       CA02g02750 121 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 165
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.835661IPR017884SANT domain
SMARTSM007175.3E-8759IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-11965IPR009057Homeodomain-like
CDDcd001671.86E-81157No hitNo description
PfamPF002492.8E-71153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-41163IPR009057Homeodomain-like
PROSITE profilePS5129417.581113170IPR017930Myb domain
SuperFamilySSF466891.27E-16116171IPR009057Homeodomain-like
SMARTSM007173.2E-10118168IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.6E-17118168IPR006447Myb domain, plants
CDDcd001678.38E-10121166No hitNo description
PfamPF002492.7E-11121165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-10121164IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MTIDESSSSI WSREQDKAFE NALATYPEDS ADRWEKIATD VPEKTLEEVK HHYDLLLEDV  60
SRIESGSVPL PCYNSSSDSS TSHGGDDGTG KKTGNSGNLN GESNHGGKSM RADQERRKGI  120
AWTEDEHRLF LLGLDKYGKG DWRSISRNFV VTRTPTQVAS HAQKYFIRLN SMNRDRRRSS  180
IHDITSVNAG EVSVPPGPIT GQANGSSAGS SSSKPNKQQT PVRATPLGVS IYGETSIGQP  240
IGGPFVSAVG TPVNLPPPTH MEYGVLPPIP GAVVPGAPKN VGPLTYPMPH TSMHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1711761176RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579879.10.0PREDICTED: transcription factor DIVARICATA-like isoform X2
SwissprotQ9FNN61e-117SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A2G3A4M60.0A0A2G3A4M6_CAPAN; Transcription factor DIVARICATA
STRINGXP_009613368.11e-179(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41492445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-100MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]