PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g00230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 197aa    MW: 22561.2 Da    PI: 6.796
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g00230genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
       CA02g00230 15 KGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding55.41.4e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
       CA02g00230  68 RGNITPEEQLLIMELHAKWGNK-WSKIAKHLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-24765IPR009057Homeodomain-like
PROSITE profilePS5129415.9171062IPR017930Myb domain
SuperFamilySSF466891.09E-3013109IPR009057Homeodomain-like
SMARTSM007178.1E-131464IPR001005SANT/Myb domain
PfamPF002491.3E-161562IPR001005SANT/Myb domain
CDDcd001672.68E-101762No hitNo description
PROSITE profilePS5129425.80863117IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2566117IPR009057Homeodomain-like
SMARTSM007175.2E-1567115IPR001005SANT/Myb domain
PfamPF002491.7E-1668111IPR001005SANT/Myb domain
CDDcd001676.99E-1272111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MDKRPCNSQD AEVRKGPWTM EEDLILINYI ANHGEGVWNS LAKSAGLKRT GKSCRLRWLN  60
YLRPDVRRGN ITPEEQLLIM ELHAKWGNKW SKIAKHLPGR TDNEIKNYWR TRIQKHIKQP  120
ENVNGQGTSE QNIDHQEGSS SQMSSAGQVD TIETYSPTSY NGNMDANFQA PNFLTETNDN  180
MWSMEDIWSM QLLHGD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251011722128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU1116780.0EU111678.1 Nicotiana langsdorffii x Nicotiana sanderae MYB305 protein v2 (MYB305-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016559089.11e-146PREDICTED: myb-related protein 305
SwissprotP813911e-104MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A1U8FTL01e-145A0A1U8FTL0_CAPAN; Transcription factor MYB21
TrEMBLA0A2G2Y0Q81e-145A0A2G2Y0Q8_CAPAN; myb-related protein 305
TrEMBLA0A2G3D3J91e-145A0A2G3D3J9_CAPCH; Transcription factor MYB21
STRINGSolyc02g067760.2.11e-132(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.11e-86myb domain protein 21
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]