PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g32550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 227aa    MW: 26132.1 Da    PI: 10.8881
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g32550genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.2e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed ll +++k++G g  W++ +++ g+ R++k+c++rw +yl
       CA01g32550 14 KGAWTAKEDMLLTEYIKEHGEGtGWRALPKKAGLLRCGKSCRLRWVNYL 62
                     79********************99*********99************97 PP

2Myb_DNA-binding56.65.7e-1868113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T+eEd+l+v++ ++lG++ W++Ia +++ gRt++++k++w+++l
       CA01g32550  68 RGTFTPEEDDLIVRLYTLLGSR-WSLIAGRIP-GRTDNDIKNYWNTHL 113
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.737962IPR017930Myb domain
SuperFamilySSF466891.36E-2711109IPR009057Homeodomain-like
SMARTSM007171.4E-101364IPR001005SANT/Myb domain
PfamPF002493.8E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-211569IPR009057Homeodomain-like
CDDcd001671.22E-61662No hitNo description
PROSITE profilePS5129424.66263117IPR017930Myb domain
SMARTSM007171.1E-1467115IPR001005SANT/Myb domain
PfamPF002491.0E-1568113IPR001005SANT/Myb domain
CDDcd001677.24E-1070113No hitNo description
Gene3DG3DSA:1.10.10.608.3E-2570118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MGRKPCCSKE GLKKGAWTAK EDMLLTEYIK EHGEGTGWRA LPKKAGLLRC GKSCRLRWVN  60
YLKPGLKRGT FTPEEDDLIV RLYTLLGSRW SLIAGRIPGR TDNDIKNYWN THLLKKLKAQ  120
GNEPRRHKSI RKSKEKEKAS SQKKQTRNQK TKERKKKRKI AENDSNIEER EQVAKKTEEQ  180
LQMQDFSQAV SENNYNFTGK LIGSRNILLL KSLLSRLKST LSVKKX*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A8e-27141442129MYB3
3zqc_D8e-27141442129MYB3
3zqc_G8e-27141442129MYB3
3zqc_J8e-27141442129MYB3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113131LKKLKAQGNEPRRHKSIRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754473e-79HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016557730.11e-145PREDICTED: myb-related protein 308-like
TrEMBLA0A2G3ANV31e-144A0A2G3ANV3_CAPAN; Myb-related protein
TrEMBLA0A2G3DHE51e-144A0A2G3DHE5_CAPCH; Myb-related protein
STRINGXP_009765022.12e-96(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.16e-62myb domain protein 3