PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g27790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 143aa    MW: 16554.1 Da    PI: 11.0103
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g27790genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding475.8e-15653148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEde l++ vk++G+++W++I ++  + Rt+k+c++rw  y+
       CA01g27790  6 KGPWKAEEDEVLIKHVKKYGPRDWSSIRSKGLLQRTGKSCRLRWVRYR 53
                     79*************************8887799**********9986 PP

2Myb_DNA-binding45.31.9e-145897344
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     ++++eE+   +++ +q+G++ W++Ia +m  gRt++++k++w
       CA01g27790 58 KFSAEEERTVIELQAQFGNK-WARIATYMS-GRTDNDVKNFW 97
                     89******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.918157IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-19352IPR009057Homeodomain-like
SuperFamilySSF466896.36E-28497IPR009057Homeodomain-like
SMARTSM007172.1E-7554IPR001005SANT/Myb domain
PfamPF002497.3E-13653IPR001005SANT/Myb domain
CDDcd001671.30E-10852No hitNo description
SMARTSM007173.2E-1155103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-165899IPR009057Homeodomain-like
PfamPF002491.6E-125897IPR001005SANT/Myb domain
CDDcd001674.32E-95897No hitNo description
PROSITE profilePS5129415.05658105IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MSEIKKGPWK AEEDEVLIKH VKKYGPRDWS SIRSKGLLQR TGKSCRLRWV RYRPFGVKFS  60
AEEERTVIEL QAQFGNKWAR IATYMSGRTD NDVKNFWSSR QKRLAKILRN SAPQPNKPQK  120
CIHREAPPAT QKVPSVEVIH HS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-25310324126MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression (PubMed:15694308, PubMed:15618418, PubMed:19300502, PubMed:21285328). Binds to canonical MYB sites 5'-AACCGTC-3', 5'-AAACCGC-3' and 5'-AACCGT-3' in promoters to trigger the expression of male germline-specific or enriched genes (e.g. MGH3, GEX2 and GCS1), including those required for fertilization (PubMed:21285328, PubMed:19300502). Required for sperm cell specification leading to pollen maturation by activating a germline-specific regulon (PubMed:21285328, PubMed:15694308, PubMed:15618418, PubMed:19300502). Involved in pollen mitosis entry at G2-M transition via the regulation of CYCB1-1, DAZ1 and DAZ2 expression (PubMed:15618418, PubMed:19300502, PubMed:24876252). {ECO:0000269|PubMed:15618418, ECO:0000269|PubMed:15694308, ECO:0000269|PubMed:19300502, ECO:0000269|PubMed:21285328, ECO:0000269|PubMed:24876252}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA 159 (miR159); the production of miR159 is stimulated by the anaphase promoting complex/cyclosome (APC/C) (PubMed:21441434). Activated by ARID1 in male germline cells via specific histone acetylation regulation (e.g. H3K9Ac) (PubMed:25057814). {ECO:0000269|PubMed:21441434, ECO:0000269|PubMed:25057814}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0325375e-80AB032537.2 Nicotiana tabacum B25 mRNA for hypothetical protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016561472.15e-90PREDICTED: transcription factor MYB59
SwissprotA0A178VEK71e-61DUO1_ARATH; Transcription factor DUO1
TrEMBLA0A1U8FQG41e-88A0A1U8FQG4_CAPAN; transcription factor MYB59
STRINGSolyc01g090530.1.11e-75(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42072342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.14e-64MYB family protein
Publications ? help Back to Top
  1. Zheng B,He H,Zheng Y,Wu W,McCormick S
    An ARID domain-containing protein within nuclear bodies is required for sperm cell formation in Arabidopsis thaliana.
    PLoS Genet., 2014. 10(7): p. e1004421
    [PMID:25057814]
  2. Peters B, et al.
    A Conserved cis-Regulatory Module Determines Germline Fate through Activation of the Transcription Factor DUO1 Promoter.
    Plant Physiol., 2017. 173(1): p. 280-293
    [PMID:27624837]
  3. Zheng Z, et al.
    Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy.
    Plant Physiol., 2017. 174(3): p. 1764-1778
    [PMID:28515145]