PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA01g26690 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 90aa MW: 10665.3 Da PI: 7.2494 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 55.3 | 1.3e-17 | 2 | 69 | 296 | 364 |
GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364 n++ e+a+r+erhe le+Wr+r++++ Fkp+pls+++++++k+ll++++ + y+++ ++g l++gW++ CA01g26690 2 NILKYEEAKRVERHELLERWRSRFSMVNFKPYPLSSSINATIKTLLENYY-RSYTLDMRNGVLYFGWMN 69 8999**********************************************.66**************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 11.915 | 1 | 60 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 4.4E-15 | 2 | 69 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MNILKYEEAK RVERHELLER WRSRFSMVNF KPYPLSSSIN ATIKTLLENY YRSYTLDMRN 60 GVLYFGWMNG DESQFGCFLC LEIVILPEV* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016581393.1 | 4e-33 | PREDICTED: scarecrow-like transcription factor PAT1 | ||||
Swissprot | Q9LDL7 | 9e-23 | PAT1_ARATH; Scarecrow-like transcription factor PAT1 | ||||
TrEMBL | A0A2G3ALX8 | 1e-59 | A0A2G3ALX8_CAPAN; Uncharacterized protein | ||||
TrEMBL | A0A2G3DIS9 | 4e-59 | A0A2G3DIS9_CAPCH; Scarecrow-like transcription factor PAT1 | ||||
STRING | PGSC0003DMT400057111 | 3e-31 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48150.2 | 4e-25 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|